KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_00320Help
Entry
AOT13_00320       CDS       T04476                                 

Definition
(GenBank) hypothetical protein
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF72
Motif
Other DBs
NCBI-ProteinID: ALF08612
UniProt: A0A178TW42
LinkDB All DBs
Position
complement(57244..58092)
Genome map
AA seq 282 aa AA seqDB search
MIYIGLTGWGDHDSLYPPGLAAKDKLQEYAAHFPTVEVDSYFYAIQPRQNVEKWIRETPD
SFRFVVKAYQGMTGHERGPIPYSSKEEMFAAFLDSIEPFIRSGKLAMVLFQFPPWFDCRR
EHVTYLRWCKAQMKEVPVALEFRHRSWFSPRFYAKTLQFMTEEGWIHSICDEPQAGEGSI
PTVLHPTNAEKTLVRLHGRNVYGWNKATSGENWRAVRYLYRYREDELREWVAHIETLKTK
TNDIYVLFNNNSGGDAADNAKQFIRLLGIEYTDLAPRQLDLF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatagggttaaccggttggggtgatcacgacagcttatatcctccaggtctt
gccgcgaaagataagctgcaagaatatgccgctcattttcccactgtagaagtagattcg
tatttttatgcgattcagccgcggcagaatgtcgaaaagtggattcgcgaaacgcctgac
tcgtttcgctttgtcgtgaaagcataccaaggaatgacggggcatgagcgcggcccgatt
ccatattcaagcaaagaggaaatgtttgccgcctttttagattccatcgaaccgtttatc
cgttcgggaaaactggcgatggtgctgtttcagtttccgccatggtttgattgccgccgc
gagcatgtcacatatttgcgctggtgcaaggcgcaaatgaaagaagttccggtggcgctt
gagttccgccatcgttcatggttttccccgcgtttttatgcaaaaacgttacagtttatg
acggaagaaggatggattcatagcatttgcgatgagccgcaggcaggggaaggctccatt
ccaaccgtgcttcatccgactaatgcggaaaaaacgttggttcgcttgcatggacgcaac
gtatatggatggaataaggcgacaagcggggaaaattggcgggctgtaagatatttatac
cgataccgcgaagatgaattgcgcgaatgggtggcgcatattgaaacattaaaaacgaag
acaaatgatatttatgtgttgtttaacaacaattccggcggggatgctgcggataacgcg
aagcaattcatccgcctgctcggcattgagtatacggatttagcgccacggcagctggat
ttattttag

DBGET integrated database retrieval system