KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_00410Help
Entry
AOT13_00410       CDS       T04476                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00071  Fatty acid degradation
ptl00362  Benzoate degradation
ptl00650  Butanoate metabolism
ptl01100  Metabolic pathways
ptl01120  Microbial metabolism in diverse environments
ptl01200  Carbon metabolism
ptl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOT13_00410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOT13_00410
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT13_00410
Enzymes [BR:ptl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AOT13_00410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ALF08630
UniProt: A0A369X1B3
LinkDB All DBs
Position
complement(73465..75849)
Genome map
AA seq 794 aa AA seqDB search
MVKRIQKAAVLGSGVMGLGIAAHLANVGIPTLLLDIVPRELTKEEEAKGLTLEHKEVRNR
LANQALQKLLKQKPAPFMSKSNLALIETGNFADDFHRLAEVDWIIEAVVENLEIKKSVFA
MVDEVRKPGTIVSSNTSGISIETMAEGRSEDFKKHFLGTHFFNPPRYLKLLEIIPTKDTD
PEVVSYMKTFGEEVLGKGVVMAKDTPNFIANRIGTYGLLVTVREMMKGGYSVGEVDSLTG
PLIGRPKSATFRTLDVVGLDTFIHVANNVFEKVEGEEKEAFRVPDFMKAMLEKGWIGSKS
GQGFFWKQGKDILELNYETLEYEPRKKLTTPAVEASKQAKKLNDKLKALVYADDRAGTFL
WKIIAPVLLYSAKLLGEIADDIVAIDRAMKWGFGWELGPFEMWDALGVEQSVRKMQAEGL
DIPSWVTDMLAAGFPFFYKSEKGQVFYYDRGEYKPIHENPKVIHIKRLKEQRDVIKKNSG
ASLIDLGDDVALLEFHSPNNAIGTDIVQMINYALEEVERNYKGLVIGNQGKNFCVGANLA
MILMEAQDDNYFEIELAVRQFQQAMMNIKYSTKPVVAAPFAMTLGGGVEVCLPSSRIQAA
AETYMGLVEVGVGLIPGGGGNKELYIKYLNSLPSGVHFDLQQVANKVFETIALAKVSGSA
AEARELNFLNQRDGITMNSDHLIHDAKQAVISLYDQGYRPPVRKKVPVVGETGYAAMLLG
AQSMYHSGYISEHDLKIAKKLAYVIAGGKVPYGTEVDEQYLLDLEREAFLSLVGEPKSQA
RMQHMLVKGKPLRN
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcgcattcaaaaggcggccgtgcttggatctggtgtgatgggtttaggaatt
gcggcacatttagcgaatgtggggataccgacattgcttctcgatattgttccgcgcgag
ttgacaaaggaagaggaagcaaaagggctaacacttgaacataaagaagtacgcaaccgt
cttgctaatcaagcattgcaaaagttgttgaaacaaaagccggcgccgtttatgtccaaa
tccaatcttgctcttattgaaacaggaaattttgcggatgactttcaccgtcttgctgaa
gtggattggattattgaagcagtcgtggaaaatttagaaattaagaaaagcgtatttgca
atggtggatgaagtaagaaaaccgggaacgatcgtcagctcgaacacttcgggaatttcg
atcgaaacgatggcagaaggccgttccgaagactttaaaaaacattttttaggaacgcat
ttcttcaatccgccgcgctatctaaagctgcttgaaatcattccgacgaaagatacagat
ccagaagttgtttcatatatgaaaacatttggcgaagaagtgcttggcaaaggggttgtc
atggcgaaagatacgccaaatttcattgcaaaccgaatcggcacgtatggcttgttagta
actgttagagaaatgatgaagggcggatacagcgtcggagaagtcgattcgcttacaggg
ccgctgattggccgcccgaaaagcgcaacattccgcacgcttgatgtcgtcggcttggac
acatttattcatgttgccaataacgtatttgaaaaagtagaaggggaagaaaaagaggcg
tttcgcgttccggattttatgaaagcgatgctggaaaaagggtggatcggcagcaaatca
gggcaaggcttcttttggaaacaaggaaaagatattttggagcttaattatgagacgctg
gaatatgagccgcgcaaaaagctgacgactccagcggtggaagcgagcaagcaggcgaaa
aagctgaatgataaattgaaagcgcttgtatatgcggatgaccgcgctggaacgttcctt
tggaaaatcattgctccagttctcctctattctgcgaaattgcttggcgaaatcgctgat
gacattgtcgctatcgaccgcgcgatgaaatggggatttggctgggagcttggtccgttt
gaaatgtgggatgcgcttggtgttgagcaatctgtccggaaaatgcaagcagaaggattg
gacattccttcgtgggtaacggatatgcttgcggctggcttcccgtttttctacaaatcg
gaaaaagggcaagtattttattatgatcgcggagaatacaagccaattcatgaaaacccg
aaagtcattcacataaagcgcttgaaggaacaaagagatgtcattaagaaaaacagcggc
gcaagtttaatcgatcttggcgatgatgttgcattgttagagttccactcgccaaataac
gcgatcggtacggatattgtgcaaatgattaactatgcccttgaggaagtggagaggaac
tataaagggcttgtcatcggcaatcagggaaaaaacttctgtgtcggtgcaaaccttgcg
atgattttaatggaagcacaagatgacaactattttgaaattgagcttgctgttcgccaa
ttccaacaagcaatgatgaatattaagtatagcacgaaaccagtcgttgccgcgccgttt
gcgatgacgctcggaggcggtgtggaagtttgcctgccatcatcccgcattcaagccgcg
gcggaaacgtatatggggcttgtcgaagtcggcgtcggcctcattcctggcggcggcgga
aataaagagctttatatcaaatatttaaatagtctgccaagcggagttcatttcgatttg
cagcaagtagcgaataaagtgtttgaaacgatcgcgctggcaaaagtatccggatctgcg
gcagaagcgcgtgaactaaattttttaaatcagcgtgatggcattacgatgaatagcgat
catttaattcatgatgcgaagcaggcggtcatttctctttatgatcaaggttatcgtccg
cctgttcgcaaaaaggtgcctgttgtcggcgaaacaggttatgcggcgatgctgctcggc
gcgcagtcgatgtatcactctggatacattagtgaacacgatttgaaaatcgcgaaaaaa
cttgcgtacgtcattgctggcggaaaagtcccgtacggcacggaagttgatgaacaatat
ttgcttgatttagaaagggaagcgtttttaagcctggtcggcgaaccgaaatcacaggcg
agaatgcagcatatgcttgttaaagggaaaccgctgcgcaactaa

DBGET integrated database retrieval system