KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_01135Help
Entry
AOT13_01135       CDS       T04476                                 

Definition
(GenBank) flagellar biosynthesis protein FliW
  KO
K13626  flagellar assembly factor FliW
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ptl02035]
    AOT13_01135
Bacterial motility proteins [BR:ptl02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    AOT13_01135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliW
Motif
Other DBs
NCBI-ProteinID: ALF08759
UniProt: A0A1Y3PVJ9
LinkDB All DBs
Position
complement(218191..218634)
Genome map
AA seq 147 aa AA seqDB search
MKITSKFLGEIEINEEQIIHFPNGIPGFEEEKQFVILPLEEQSPFAILQSIHHSHVGFVI
AYPFSFYPDYAFDLTEEDIEKLKLNSPDDCLTYTIMTLKEPFADSTINLKAPIVINVKEK
IGKQLILHDSVYPIRFPLSEARGKEGK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacatcaaaatttttaggagaaattgaaataaatgaagaacaaattatccat
tttccaaacgggatacctggatttgaagaagaaaagcaatttgtcattttgccattagaa
gaacaatcgccgtttgcgattttacagtcgattcatcacagccatgtcggctttgtcatt
gcttatccattctctttctacccggattatgcgtttgatttaacagaagaagatattgaa
aagctgaaattgaattctcctgatgattgcttgacatatacgattatgacgctaaaagag
ccgtttgctgattctaccattaacttaaaagctccaatcgttattaacgtgaaagaaaaa
ataggaaagcaactcattcttcatgacagcgtctacccgatccgttttccgttgtccgag
gcgcgcgggaaggagggaaaataa

DBGET integrated database retrieval system