KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_01635Help
Entry
AOT13_01635       CDS       T04476                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00010  Glycolysis / Gluconeogenesis
ptl00620  Pyruvate metabolism
ptl01100  Metabolic pathways
ptl01110  Biosynthesis of secondary metabolites
ptl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOT13_01635
   00620 Pyruvate metabolism
    AOT13_01635
Enzymes [BR:ptl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AOT13_01635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 OmdA
Motif
Other DBs
NCBI-ProteinID: ALF08847
UniProt: A0A178TTZ4
LinkDB All DBs
Position
335579..337099
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGSLITFKKRYENFIGGKWVPPVDGEYFENISPVTGKPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARILNKIADRIEENLEMLAVAETWENGKPIRETLNADIPL
AIDHFRYFAGCIRAEEGTLAEIDNDTVAYHFKEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPTSILVLMELIEDLLPPGVVNIVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVAAKDDEFFDKAIEGFTLFALNQGEI
CTCPSRALIQESIYDQFIERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNFLEGDLRDGYYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKDVNEAL
EIANETLYGLGAGVWTRDINTAYRVGRGIQAGRVWTNCYHIYPAHAAFGGYKLSGFGRET
HKMMLEHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgctcaacctgggcaacctggttcgctcatcactttcaaaaaacgctatgaa
aatttcattggcggcaaatgggttccgccggtcgatggcgagtattttgaaaacatctct
ccagtcaccgggaaaccttattgtgaagtgccgcgttccaaagcagcagacattgagtta
gcgttagacgctgcccatgccgcgaaagacgcgtggggccgcacttcccctgccgaacgc
gcgcgaatcctcaacaaaatcgccgaccgcatcgaagaaaacttggaaatgctcgctgtt
gcggaaacatgggaaaacggcaagccgattcgcgaaacgctgaatgcggacattccgctt
gccatcgatcatttccgctattttgccggctgcatccgcgcagaagaagggacgttagcg
gaaatcgacaatgatacagtcgcctatcactttaaagaaccgcttggggttgtcgggcaa
atcatcccatggaacttcccgcttttaatggcaacttggaagctcgcgccagcattagcc
gcgggaaactgcgttgtcctgaaacctgcagaacaaacgccaacttcgatcctcgtgctt
atggaactcattgaagatttgcttcctccaggtgttgtcaacatcgtcaacggattcggc
ttggaagccggaaaaccgctcgcttcaagcaaccgcatcgcgaaaattgcattcaccggt
gaaacgacaacagggcgtttaattatgcaatacgcatcgcaaaacattatcccagtaaca
ttagagcttggcggaaaatcgccgaacattttcttcgaagacgttgcggcaaaagatgat
gaatttttcgataaagccattgaaggctttacgctgttcgcgttaaaccaaggtgaaata
tgtacgtgcccttcccgcgctctcattcaagaatcgatttacgaccaatttatagagcgt
gcgttagagcgcgttaaacaaataaaacaaggcaacccgctcgacacggaaacgatgatc
ggcgcccaagcatcttcggaacaattggaaaaaatattatcgtacattgatatcggcaag
caagaaggtgccgaattgcttatcggcggagaacgcaacttcttagaaggagacttaaga
gacggctattacgtgaaaccgacggttttcaaaggccataataaaatgcgcattttccaa
gaagaaattttcgggccggttgtctccgtcacgacatttaaagatgtcaacgaggcgttg
gagatcgccaacgaaacattgtacggtttaggcgccggcgtctggacacgcgacattaac
accgcttatcgcgttggacgcggcatccaggcaggacgcgtctggacaaactgctaccac
atctatcctgcgcacgcggcattcgggggctataagttatccggattcggccgtgaaacg
cataaaatgatgcttgaacattatcaacaaacgaaaaacttgcttgtcagctattcaccg
aaaaaacttgggctcttctag

DBGET integrated database retrieval system