KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_03690Help
Entry
AOT13_03690       CDS       T04476                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00010  Glycolysis / Gluconeogenesis
ptl00071  Fatty acid degradation
ptl00350  Tyrosine metabolism
ptl00625  Chloroalkane and chloroalkene degradation
ptl00626  Naphthalene degradation
ptl01100  Metabolic pathways
ptl01110  Biosynthesis of secondary metabolites
ptl01120  Microbial metabolism in diverse environments
ptl01130  Biosynthesis of antibiotics
ptl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOT13_03690
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOT13_03690
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AOT13_03690
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AOT13_03690
   00626 Naphthalene degradation
    AOT13_03690
Enzymes [BR:ptl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AOT13_03690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_25 UDPG_MGDP_dh_N Methyltransf_11 Methyltransf_31 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALF09200
UniProt: A0A178U284
LinkDB All DBs
Position
complement(745083..746105)
Genome map
AA seq 340 aa AA seqDB search
MKAAVVNEFKQKLEIKEVEKPKLNYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVVEVAEGVKSVKVGDRVGIPWLYSACGECEYCLSGQETLCPHQLNGGYSADGGY
AEYCKAPANYVAKIPEHLDPVEVAPILCAGVTTYKALKVSNAKPGEWVAIYGIGGLGHIA
LQYAKAMGLNVIAVDISDEKIELAKQLGADIAINGLKEDPVEAIQQNVGGAHAAISVAVT
KKAFEQAYQSVRRGGCLVVVGLPNEDLPIPIFNTVLNGITVKGSIVGTRKDMQEALDFAA
RGKVRPIVETAPLEKINEVFERMEKGKINGRVVLTIGVNR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcagttgtcaacgagtttaaacaaaaattagaaattaaagaggtggaaaaa
ccaaagctgaattacggagaggtgcttgttaaaattgaggcttgcggcgtttgccacacc
gatttgcatgcggcgcacggagactggccggtcaagccaaagcttcctttgattcctgga
cacgaaggggtaggcatcgtcgtcgaggtggcagaaggggtaaaatcggttaaagtagga
gaccgtgtcggcattccatggctgtactccgcttgcggagaatgtgaatattgtttgagc
gggcaagaaacgctttgtccgcatcaattaaatggcggatattctgccgatggaggatat
gcggaatactgcaaagcgcctgccaattatgtcgcaaaaattccggaacacttggatccg
gtggaagtcgcgcctattctttgcgcgggggtaacgacatacaaagcgctaaaggtatct
aacgccaaaccgggagaatgggtcgccatttacggaatcggagggttagggcatatcgcc
cttcaatacgcgaaagcaatgggattaaacgtcatcgcggtcgatattagcgatgaaaag
atagagcttgcgaaacaattaggcgctgatatcgccatcaatggacttaaagaagatcct
gtggaagccatccagcaaaacgtgggcggagcgcatgccgccattagcgttgccgtcacg
aaaaaagcgttcgaacaagcctatcaatccgtgagacgcggcggatgccttgttgttgtc
ggtctgcctaatgaagacttgccaattcctattttcaacacagtattaaatggaataacg
gtgaaaggatccatcgtcggcacgagaaaagatatgcaagaagcgttggatttcgccgcg
cggggaaaagtgcgcccgatcgtcgaaaccgctccattggaaaaaatcaatgaagtattt
gaaagaatggaaaaaggaaaaattaacggccgagtcgttttaaccatcggtgtcaaccgt
taa

DBGET integrated database retrieval system