KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_05405Help
Entry
AOT13_05405       CDS       T04476                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AOT13_05405
Enzymes [BR:ptl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AOT13_05405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ALF09493
UniProt: A0A178TV42
LinkDB All DBs
Position
1106711..1108192
Genome map
AA seq 493 aa AA seqDB search
MKVLNFIHGEWKASISRQFAPVINPANGETIGEVTVSIEADVDEAVKSAKAAQKGWALVP
APKRAEVLYKVGYLLKERKEQLARLLTTEMGKVLEEARGEVQEGIDMAFYMAGEGRRLFG
DTTPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPALETPLM
AQELAKIFEEAGLPKGVFNVVHGDGPTTGNALVEHPDVQVISFTGSNEVGRIIAEKCGRR
LKKVSLEMGGKNAVIVMDDADLSLAVEGILWSAFGTSGQRCTACSRVLVHEKVKEELENR
LLEAMKTLTIGNGLDESVKVGPVISEEALQNIDRYVQIGKEEGAKLLTGGYILRDGEYQK
GYYYAPTLFTDVQATMRIAREEIFGPVVSIISVNSLEEAIVVNNSVDYGLSSSIFTRDVN
KAFQAMRDLDTGIVYVNAGTIGAEIHLPFGGTKGTGNGHRDSGIAALDVFTEWKSVYIDF
SGKLQRAQIDIDE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtattgaattttattcatggggaatggaaagcatcgattagcaggcaatttgct
ccggtgatcaatccggcaaacggcgaaacgattggagaagtgacggtttcgatcgaagcg
gatgtcgatgaagcggtaaaatcggcaaaggccgcacaaaaagggtgggcgcttgtaccg
gcaccaaaacgggcggaagtgttatataaagtcggctatttattaaaagagagaaaagaa
cagcttgcaagactactgacgacggaaatgggaaaagtgcttgaggaagcgcgcggggaa
gtgcaagaaggaattgacatggcgttttatatggctggcgaagggaggcgtctgttcggc
gacacgacgccttcggaattgaaagataaatttgcgatgagcgtccgcgtgccagttgga
gttgtcggcatcatcacgccgtggaattttccgattgcgatcgcaacatggaaatcgttc
ccggccattgttgccggcaatgcggttgtatggaagccagctttggaaacaccattgatg
gcgcaggaactggcaaaaatattcgaggaagcgggattaccaaaaggcgtgtttaacgtc
gttcacggcgacggcccaacgacaggaaatgcattggtagagcatccggacgtgcaagtg
atttcctttaccgggtcaaacgaagtcggacggattattgccgaaaaatgcggacgccgc
ttgaaaaaagtatcgctggaaatgggcggaaaaaatgctgtcattgtcatggatgacgct
gatttatcgttagcggtagaagggattttgtggagcgcgtttggcacgtcggggcaaaga
tgtacggcatgcagccgtgtccttgttcatgaaaaggtgaaggaagagctggaaaataga
ttgctagaagcaatgaagacattaacgattggaaacggattggacgaaagcgtcaaagtc
ggcccggtcattagcgaagaggcgctgcaaaacattgaccgttatgtgcaaatcggcaag
gaagaaggtgcaaagctattaaccgggggctatattttgcgggatggagagtatcaaaaa
ggctattattatgccccgactctctttacggatgttcaagcaacgatgcgaattgcgcgc
gaggaaattttcggcccggttgtttcgatcatttccgtcaatagtttagaagaagcgatt
gtcgtgaacaacagtgttgattacggattgtccagctccatttttacacgggatgtcaat
aaagcattccaagcgatgcgcgatttagatacaggtattgtctatgtcaatgccggcacg
attggggcggaaattcatctgccgtttggcggcacgaaaggaacgggaaacggccatcgt
gactctggcatcgcggcgctcgatgtgtttacggaatggaaaagcgtgtatattgatttc
agcggcaaactgcaacgggcgcaaatcgatattgacgaataa

DBGET integrated database retrieval system