KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_08115Help
Entry
AOT13_08115       CDS       T04476                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00020  Citrate cycle (TCA cycle)
ptl00310  Lysine degradation
ptl00380  Tryptophan metabolism
ptl01100  Metabolic pathways
ptl01110  Biosynthesis of secondary metabolites
ptl01120  Microbial metabolism in diverse environments
ptl01130  Biosynthesis of antibiotics
ptl01200  Carbon metabolism
Module
ptl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ptl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT13_08115
  Amino acid metabolism
   00310 Lysine degradation
    AOT13_08115
   00380 Tryptophan metabolism
    AOT13_08115
Enzymes [BR:ptl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AOT13_08115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ALF09971
UniProt: A0A178U098
LinkDB All DBs
Position
1634210..1637068
Genome map
AA seq 952 aa AA seqDB search
MAKQTISNAEPWSQFYGPNLGYVMEKYEQYLEDPDSVDPELKQLFEQWGAPPAEAERFEY
SESAAKTHQTFRLPENPTIFSKLVAAVKLADNIRHYGHLAADVNPLNKQNKDLRRIELSE
FDLTEEDLKEIPVPFICPHAPSHVRNGLDAINHLRKIYTDKIAFEFSQVHNLEEKNWLIR
EIESGAYYPSLSNEEKVALLRRLTEVEGFEKFLHRTFVGQKRFSIEGLDSMVPLLDELVR
HSIENEVKAINIGMAHRGRLNVLAHVLGKPYEMIFAEFQHAESKDFIPSEGSVAITYGWT
GDVKYHLGAARRLRNKNEHTMRITLANNPSHLEVVSPVVLGFTRAAQEDRSNAGVPSQDT
DSSFAIMIHGDAAFPGQGIVAETLNLSRLRGYQTGGSIHIIANNMIGFTTESYDSRSTRY
ASDIAKGFEIPIVHVNADDPEACLAAANLAFKYRQRFKKDFVIDLIGYRRFGHNEMDEPM
ATNPTMYNVIQQHPTVRQLYAQKLVEKGVIAKEAVEEMEREVAERLKNAYERVPKDETKL
DFIMDPPKPVARKLPFVKTAVEKEVLRRLNKELLQFPPNFHVFNKLERILKRRDGVFDGN
GKIDWAHAEILAFATILRDGVPIRLTGQDSQRGTFAQRHLVLHDVKTGEEFVPLHHISEA
NASFVVYNSPLTEAAVLGYEYGYNVFAPETLVLWEAQFGDFANMAQVMFDQFISSGRAKW
GQKSGLVMLLPHGYEGQGPEHSSARLERFLQLAAENNWTVANLSTSAQYFHILRRQASIL
QWEEVRPLVLMTPKSLLRHPLAASDVEEFTNGQFQPVLEQKGLGENREKVERIILGTGKL
TVDLAEQINKMEGLDWLHVVRIEELYPFPKEELQAILVRYPNIKEIVWVQEEPQNMGSWC
YVEPKLREIAPDGVDVSYIGRRRRASPAEGDPVVHRKEQERIIQCALTKKEQ
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcaaacgataagcaacgcagaaccatggagtcagttttatggtccgaacctt
ggatacgtgatggaaaagtatgaacagtatctggaggacccggacagcgtcgaccccgaa
ttgaagcagctgtttgaacagtggggggcgccgccagcggaagccgaacggtttgagtat
agcgaaagcgccgcgaaaactcaccaaacgttccgtcttcctgagaatccgacgatattt
agcaaactcgttgcggccgttaagctagctgacaacattcgtcattacggccatctggca
gcagatgtcaacccattaaacaagcaaaataaagatttgcgacgcattgagttaagtgaa
ttcgatctgacggaagaagatttaaaagaaattccggttccgtttatttgcccgcacgcg
ccttcgcacgtccgcaatggattggatgcgattaaccatttaagaaaaatatatactgat
aaaattgcttttgaattttcgcaagtacataatttagaagaaaaaaactggttaattcgg
gaaattgaatcaggtgcatattacccaagtttgtcgaatgaagaaaaggtggccttgctt
cgccgccttacggaagtggaaggatttgaaaagtttcttcatcgcacgtttgtcggccaa
aagcgtttttccatcgaagggttggattcgatggttccgctgctggacgaactcgtccgc
cattccattgagaatgaagtgaaagcgattaatatcggcatggcgcaccgcggacgctta
aatgtgctcgctcacgttcttggcaagccgtatgaaatgatttttgccgagtttcaacat
gcggaaagcaaagatttcatcccgtcggaaggttcggtagcgattacgtatggctggacg
ggggatgtaaaataccatttgggcgcagcacgccgcttgcgaaacaaaaatgagcatacg
atgagaataacgctggcgaacaacccgagccatctcgaagtagtcagcccggtcgtttta
gggtttacacgcgctgcccaagaggatcgctcgaacgcgggcgtgccgtctcaagataca
gattcgtcgttcgccattatgattcacggagacgcggcatttcctggacagggaattgtc
gcagaaacattgaacttaagccgcttgcgtggatatcagacgggcgggtcgattcatatt
attgcgaacaatatgatcggcttcacgacagaaagctatgattcacgttccacgagatac
gcatctgacatcgcaaaaggctttgaaataccgattgtgcatgtaaacgccgacgatccg
gaagcgtgtttggcggcggcgaaccttgcgtttaaataccgccagcgcttcaaaaaagat
tttgtcatcgatttaattggctaccgccgcttcggccataacgaaatggatgaaccgatg
gcgacaaatccgacaatgtataacgtgatccaacagcacccgacggttcgccaactttat
gcgcaaaagctggtggaaaaaggggttattgcaaaagaagcggttgaagagatggaacgg
gaagttgccgagcgcttgaaaaacgcgtacgaaagagttccgaaagacgagacaaagctc
gactttatcatggatccgccgaaaccggtggcaagaaaattgccatttgttaaaacggct
gtggaaaaagaggtattgcgccggctgaacaaagagttattgcagtttcctcctaatttc
catgtgtttaataagttagagcgcattttaaaacgccgcgacggcgtgtttgacggcaat
gggaaaattgattgggcgcatgcggaaattcttgctttcgcgacgattttgcgcgatggt
gtcccaatccggcttaccggccaagattcgcagcgcggtacgttcgcccaacgccatctt
gtgttgcatgatgtgaaaacaggcgaagaatttgtgccgcttcatcatattagcgaagcg
aacgcctcgtttgttgtttacaacagcccgctgacagaagcagcagtgctgggctacgaa
tacgggtataacgtctttgcgccggaaacgctcgttttatgggaggcgcaattcggcgac
tttgccaatatggcgcaagtaatgtttgatcagtttatttcgtccggacgggcgaaatgg
ggacaaaaatcaggccttgttatgctgcttccgcacgggtatgaaggacaaggtccggaa
cattcgagtgcccgtttagaacggtttttgcaattagcggcggaaaataactggacggta
gcgaacctgtctacatctgcccaatatttccatattttgcgccggcaagcgagcattttg
caatgggaggaagtgcgcccgttagtgctgatgacgccgaaaagcctgctgcggcatccg
ctggctgcttcggatgtggaagagttcacgaacggacagttccagcctgttcttgaacaa
aaagggcttggcgaaaaccgcgagaaagtggaaagaatcattttaggcacaggaaagttg
acggttgatttggcggaacaaatcaataaaatggaaggtttagattggctccatgtcgta
cgcatagaagaattgtatccattcccgaaagaggaactgcaagcgattttagtgcgctat
cctaacattaaggaaatcgtatgggttcaagaagaaccgcaaaacatgggaagctggtgt
tatgtcgagccgaaattgcgtgaaatcgctccagatggggtagatgtaagctatatcgga
agacgcagacgggcgagccctgcagaaggcgatcctgtcgtccatcgaaaagaacaagaa
cgcatcattcaatgtgcattaacgaaaaaagaacaataa

DBGET integrated database retrieval system