KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_18120Help
Entry
AOT13_18120       CDS       T04476                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00480  Glutathione metabolism
ptl01100  Metabolic pathways
ptl01110  Biosynthesis of secondary metabolites
ptl01120  Microbial metabolism in diverse environments
ptl01130  Biosynthesis of antibiotics
ptl01200  Carbon metabolism
ptl01210  2-Oxocarboxylic acid metabolism
ptl01230  Biosynthesis of amino acids
Module
ptl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT13_18120
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AOT13_18120
Enzymes [BR:ptl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AOT13_18120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALF12129
UniProt: A0A1Y3PYS7
LinkDB All DBs
Position
complement(3676857..3678128)
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKQTGEWLPQETLDVIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEQGTKRLVRAAIKYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EEEFSDKVFTWAQYDRIVETEGKEAANKALAEAEEAGKIIIKDVIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIVDALEKTIASKIVTYDFARLMEGATEVKCSEFADAIIR
NME
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggggaaaaaattacagtaacgaatggtgtgttaaacgtaccaaacaatccg
attattccatttattgaaggagacgggacaggaccggacatttgggcggcggcatcccgc
gtgttagaagctgcggtcgaaaaggcgtataaaggcgaaaagaaaatcgtttggaaagaa
gtgcttgcgggtgaaaaagcgtacaagcaaaccggcgagtggcttccacaagaaacgctt
gatgtgattcgtgaatacataattgctattaaaggtccattaacgactccggtcggcggc
ggcatccgttcattgaacgtagcgctgcgccaagaattggacttattcgtttgcttgcgc
cctgtccgctattttaaaggtgttccttctccggtgaaacgccctgaagatacggacatg
gtcattttccgtgaaaacacggaagacatttacgcaggaattgagtatgcaaaaggaacg
ccagaagtgaaaaaagtgattgatttcttgcaaaatgaaatgggcgttcgcaaaatccgc
ttcccagaaacgtctggtatcggcattaagccaatttctgagcaaggaacgaagcggtta
gtgcgcgccgctatcaagtatgcgattgagcatggacgaaaatcggtgacgcttgttcat
aaaggaaatattatgaaattcacagaaggcgcatttaaaaattggggctatgaattagcg
gaagaagaatttagcgataaagtatttacatgggcacaatatgaccgcattgtcgaaaca
gaaggaaaagaagcggcgaataaagcgctggcggaagcagaagaagctggaaaaattatt
atcaaagacgtcattgccgatattttcttgcaacaaattttgacgcgcccgcgtgagttc
gatgttgtggcgacaatgaacttaaacggcgactacatttctgacgcgctggcagcgcaa
gtcggcggcattggtatcgctccgggagcgaacattaactacgaaacaggacatgcgatt
ttcgaggctactcatggaacggctccgaaatatgctggcttggacaaagtgaatccgtca
tctgtcattttgtccggtgtaatgatgtttgaacatctcggctggaacgaagcggcaaag
cttatcgtcgatgcgctggaaaaaacgattgcttccaaaatcgtcacatacgattttgcc
cgtctgatggaaggcgctactgaagtgaaatgctccgaattcgctgacgcaatcatccgc
aatatggaataa

DBGET integrated database retrieval system