KEGG   Paramecium tetraurelia: GSPATT00000787001Help
Entry
GSPATT00000787001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00020  Citrate cycle (TCA cycle)
ptm00190  Oxidative phosphorylation
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSPATT00000787001
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GSPATT00000787001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GSPATT00000787001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 GIDA FAD_binding_3 DAO Thi4
Motif
Other DBs
NCBI-GeneID: 5024257
NCBI-ProteinID: XP_001438472
Genoscope: GSPATT00000787001
UniProt: A0CJV8
LinkDB All DBs
Position
undetermined
AA seq 361 aa AA seqDB search
MFAITKQALFRQQAMKLMNRFAVVANNKPEKGPSQGHLTDKYTVIDHTYDAVVVGAGGAG
LRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWL
GDQDAITYMCKEAPKAVYELESYGLPFSRTPEGKIYQRAFGGQSLKFGTGGQAYRCCAVA
DRTGHAMLHTLFGRALGYDCIFFVEYFALDLMMDEQGACRGVVCMSMADGSIHRIRAGYT
VIATGGYGRAFQSCTSAHTCTGDGGGMTIRAGLPMEDLEFVQFHPTGIYGSGCLMTEGCR
GEGGILRNSLGERFMERYAPTAKDLASRDVVSRAMTKEILEGRGVGPEKDHIYFAFKSFT
C
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaatcacaaagtaggcactgtttagataataagcaatgaaactcatgaatcga
tttgctgtagttgccaataataagccagaaaaaggaccatctcaaggccatttgacagac
aaatacacagtcatagatcacacttatgatgcagtagttgtaggagcaggtggagctggt
ttaagagcagcatttggtttagttgaattaggttttaagactgcatgcatctctaagtta
tttccaacaagatcccatactgttgcagcacaaggaggtatcaatgcagctttaggtaat
atgacagaagatgattggagatggcatgcatatgatactattaaaggatcagattggttg
ggagattaagatgctattacatatatgtgcaaagaagcacctaaagcagtttatgaattg
gaaagttatggtttaccattctctcgtactcctgaaggcaaaatttattaaagagcattt
ggaggttagagtttgaagtttggaacaggaggataagcttatagatgttgtgcagtggct
gatcgtactggacatgctatgttacatacactttttggcagagctttagggtatgattgt
attttctttgttgaatattttgcacttgatttaatgatggatgaataaggagcttgcaga
ggagttgtatgcatgtcgatggcagatggatctatccatagaataagagctggatataca
gtaatcgcaactggagggtatggaagagcattctaatcatgtacatcagcacatacatgc
actggtgacggtggtggtatgaccatcagagcaggtttacccatggaagatttagaattt
gtataattccatcctactggtatttatggatctggatgtcttatgactgaaggatgtaga
ggagaaggaggtattcttagaaattcattgggtgagagatttatggaaagatatgctcct
actgctaaagatttagctagtagagatgttgtttcaagagctatgactaaagaaatatta
gaaggaagaggagttggaccagaaaaagaccatatttattttgcatttaaatcatttacc
tgctga

DBGET integrated database retrieval system