KEGG   Paramecium tetraurelia: GSPATT00000788001Help
Entry
GSPATT00000788001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00020  Citrate cycle (TCA cycle)
ptm00190  Oxidative phosphorylation
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSPATT00000788001
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GSPATT00000788001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GSPATT00000788001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 5024258
NCBI-ProteinID: XP_001438473
Genoscope: GSPATT00000788001
UniProt: A0CJV9
LinkDB All DBs
Position
undetermined
AA seq 258 aa AA seqDB search
MKDYQVSVKQLRSLAGKLMLPKEPAPVLPTVHYNMGGVPTNFKTEVLNQVNGKDQIVPGL
LAAGEAACASEPIHYQILLSLEDRLPIQQVKNGSQDRNNQIFLRMLVRLPLRELIDQDIM
KDHKLLPKLERIYREPCRNMQLYSELKRLYKKVWKKLRKSIQEKMMLESKTRDQIRIRKL
IIIRKNDYRRSSQQKGIPEVLMQEMIYPDRDDKNWMKHTLARIQDTKSGDVQLTYRDVIT
KTQDPKEFDTVPPKKRVY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattaccaggtatcagtgaagcagctaagatctttggctgggaagttgatgtta
ccaaaagaaccagcaccagtattaccaacagtccattataatatgggtggagtacctaca
aatttcaaaacagaagtgcttaattaagttaatggaaaagactaaattgttccaggacta
ttagcagcaggtgaagctgcttgtgcctcagagccaattcattattagatattgttgtct
ttggaagataggctgccaatttagtaggtgaaaaatggaagccaggatagaaacaaccag
atcttcctaagaatgctggtgaggctgccattgcgagaattgatagactaagacatcatg
aaggatcataaactattgcctaagttagaaaggatttatagagaaccatgtagaaacatg
cagctgtattcagaattgaaaagactctataagaaggtgtggaaaaagttaaggaaatct
attcaagaaaagatgatgttagaatcaaagacaagggattagattagaattagaaaactt
attattataaggaaaaatgactatagaaggagctctcaacagaaaggaattccagaggtg
ctcatgcaagagatgatttatcctgatagagatgataaaaattggatgaaacacactctt
gctagaattcaagatactaagtcaggagatgttcaattgacttatagagatgtcattaca
aaaactcaggatcctaaagaatttgacactgtgccaccaaagaagagagtatattga

DBGET integrated database retrieval system