KEGG   Paramecium tetraurelia: GSPATT00004073001Help
Entry
GSPATT00004073001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00500  Starch and sucrose metabolism
ptm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GSPATT00004073001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GSPATT00004073001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase SAM_PNT GHL6
Motif
Other DBs
NCBI-GeneID: 5046386
NCBI-ProteinID: XP_001460601
Genoscope: GSPATT00004073001
UniProt: A0ED37
LinkDB All DBs
Position
undetermined
AA seq 480 aa AA seqDB search
MRLLLSLFVFVALIHCKTKEEWKSRSVYQLLTDRFATSQGKSTSCNLGNYCGGDYKGMIQ
QLDYIQNLGFDAIWITPVVDNYDGGYHGYWARNMYDVNRNFGSADDLKALVNACHARDIW
VMVDVVANHMGNTNLNFNQNYPFNQSSHYHDWCDISDNDFNSHNLYNIERCRLAGLADLN
QDNQFVTEQLLQWIKWLVQEFKFDGIRIDTLMMVKTDFWYKFSNAAGVYTVGEVFDGDMN
FLKQFVGPVDALLNYPLFYTARDVFLHWRDMNAFENYYNSLTNSWGKQNIQYAGNFNDNH
DNARFLNDQVSGYIPDEVFLSDKPHLTFSAIKKLQFKAITAFCLTSVGIPMIYYGSEQLY
AGGNDPQNREVLWGNLDQSSEMYKFIQAINNARKATNAGNQDQIQRYSDSEIYAFTRGTL
FAAFSSKYDRQVTKTITYHPYAEGTTLCNIFYPTTDCIKIASGKFTLYLNYGEVKIFVPK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagattgttattgtctttgtttgtttttgttgcactcattcattgtaaaacgaaagaa
gaatggaagagtcgatcagtttattaattgcttactgatagatttgctacaagctagggc
aaatcaacctcatgcaatttgggcaactactgtggtggtgactacaagggaatgattcaa
caacttgattatattcagaatttgggatttgatgctatttggattacacctgtcgtagat
aactatgatggtggatatcatggatattgggccaggaatatgtatgacgtcaatcgaaat
ttcggttctgctgacgatttgaaggctcttgtcaacgcctgtcatgctagggacatatgg
gttatggttgatgtagtggctaatcatatgggaaacacaaatcttaatttcaattagaac
taccccttcaatcaatcatctcattatcatgactggtgtgatatctcagacaacgatttt
aactcacataatctttataatattgaaagatgtagacttgcaggtctggctgatctcaat
taagataaccaatttgttacagaataattattataatggatcaaatggcttgtctaagaa
tttaagtttgacggaatcagaattgatacactcatgatggtcaaaactgatttctggtat
aagttttccaatgctgccggtgtctatacagttggagaagtattcgatggtgacatgaat
ttcttaaaacaatttgttggtcctgttgatgccctattgaattaccctctgttctacaca
gccagagatgtgttcctacattggagagacatgaacgcatttgaaaattactataatagt
ctaaccaactcttggggcaagtaaaacattcaatatgctggaaatttcaacgacaatcac
gataatgcaagattcttaaacgaccaagtctcaggatacattccagatgaagtattctta
agtgacaaacctcatttgaccttttctgctatcaaaaagctctaattcaaggccatcact
gcgttttgtctcacctctgtgggaatccctatgatttactatggtagtgaataactctat
gctggtggtaatgatccataaaacagagaggttttgtggggtaatttggattaatcatct
gaaatgtataaattcatccaagcaatcaataatgctcgtaaggctacaaatgcaggaaat
taagactaaattcaaagatattcagactctgaaatctatgccttcaccagaggtaccttg
ttcgctgcattctcgagtaaatacgacagataagttaccaagaccatcacctatcatcca
tatgctgaaggaacaactctttgcaatatcttttatccaacaaccgattgtatcaaaatt
gctagtggaaaattcacattatatttaaattatggagaagtcaagatcttcgttccaaaa
tga

DBGET integrated database retrieval system