KEGG   Paramecium tetraurelia: GSPATT00007994001Help
Entry
GSPATT00007994001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00020  Citrate cycle (TCA cycle)
ptm00190  Oxidative phosphorylation
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSPATT00007994001
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GSPATT00007994001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GSPATT00007994001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 FAD_binding_3 GIDA DAO Thi4
Motif
Other DBs
NCBI-GeneID: 5024629
NCBI-ProteinID: XP_001438844
Genoscope: GSPATT00007994001
UniProt: A0CKY0
LinkDB All DBs
Position
undetermined
AA seq 262 aa AA seqDB search
MFRITTQALYNQQARKLVNRFCVVSKNKPEAGPSQGHLTDKYTVIDHTYDAVVVGAGGAG
LRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWL
GDQDAITYMCKEAPKAVYELESYGLPFSRTPEGKIYQRAFGGQSLKFGTGGQAYRCCAVA
DRTGHAMLHTLFGRALGYDCIFFVEYFALDLMMDDQGACRGVVCMSMADGSIHRIRAGYT
VNSNRWIWESISIMYICPYLHR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaattacaacttaggccttgtacaatcaataagccagaaaattagttaatcga
ttctgtgtggtgtcaaaaaataaaccagaagctggtccttcttaaggacatttgacagac
aaatatacagtgatagatcacacatatgatgcagttgttgtaggagcaggtggtgcaggt
ttaagagcagcatttggtttggttgagcttgggttcaagactgcttgcatttcaaagttg
tttcccactagatctcatacagtggctgctcaaggaggtattaatgcagcattgggaaac
atgacagaagatgattggagatggcatgcatacgatacaataaagggatcagattggttg
ggagaccaagatgccattacttatatgtgtaaggaggctccaaaggcagtttacgaattg
gaaagttatggtttgccattttcaagaactccagagggcaagatttattaaagagcattt
ggaggacagagtttgaaattcggaacaggaggacaagcttatagatgttgtgcagtagca
gatagaacaggacatgctatgttacacactttgtttggaagagccttgggatatgactgt
attttctttgttgagtatttcgctcttgatttgatgatggatgatcaaggagcttgcaga
ggagttgtttgtatgtcgatggcagatggatcgatccataggattagagcaggatacaca
gttaatagcaacaggtggatatgggagagcatttcaatcatgtacatctgcccatacctg
cacaggtga

DBGET integrated database retrieval system