KEGG   Paramecium tetraurelia: GSPATT00011565001Help
Entry
GSPATT00011565001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     GSPATT00011565001
Chromosome and associated proteins [BR:ptm03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     GSPATT00011565001
   HDAC complexes
    Sin3A-HDAC complex
     GSPATT00011565001
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    GSPATT00011565001
  Chromatin remodeling factors
   NuRD complex
    GSPATT00011565001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 5029146
NCBI-ProteinID: XP_001443361
Genoscope: GSPATT00011565001
UniProt: A0CYU7
LinkDB All DBs
Position
undetermined
AA seq 482 aa AA seqDB search
MIQADSDSSRRVAYFYNRLIGKFHYGKEHPMKPKRIAMAHSLIVNFGQLYRSLDVYLIRE
AQLEELKKFHDPEYVTYLSQYMSDNKVNFVKEYCSTNNDGVIPENLLEEYRLITKWSQNK
NTKNLNAEYKVGDSADNPTFSGLFSYCQFSAGASIDCAHTILTGQADIAINWSGGLHHAK
KKEAAGFCYINDIVLCILELLRIYVRVLYVDIDCHHGDGVEEAFYLTNRVMTLSFHQYGD
DFFPGTGQLNSVGLGVGRYYAVNVPLKPGISDGPYLDLFKKVTSRVMETFRPDCVVVQCG
ADSLSLDRLGALNLSIKGHGQCITYMKQFGVPLILLGGGGYTIQNVSRCWAYETGLCLGQ
NIDEPIPTNDVYYKNYSGDYHLHFPIQEHVENKNKAEDLNKIVSQVYDHLKNLENAPGIH
FHDVPYSFYPNMDLENEDDNKINMDMKQEISLSELEQEIGVSDEANAISVNSGSRKIHSK
EV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgatttaagctgattcggattcaagtagaagagtggcatacttttataatagattgata
ggaaaatttcattatggtaaggaacatcctatgaaacctaaacgtatcgcaatggctcat
agcttaatagtaaattttgggtaactatatagatcattggatgtatatctgattagagaa
gcataattagaagaattgaaaaagtttcatgatcctgaatacgttacttatttaagttag
tatatgagtgacaataaggtaaactttgtaaaagagtactgttcaacaaataatgatggt
gtaatacctgagaacctacttgaagaatatcgattaataactaaatggagtcaaaataag
aatactaagaatctgaatgcagaatacaaagtaggagactcagcagataatcctacattt
tcaggccttttctcatattgttaattcagtgcaggtgctagtatagattgcgcacataca
attttaactggataagcagatatagcaatcaattggtctggaggattgcatcatgctaag
aaaaaagaggctgctggattttgttatataaacgatatagtcttgtgtattttagagtta
ttgagaatttatgttcgagtcttgtatgtggatatagattgtcatcatggagatggagtt
gaagaagcattctatttaaccaatagagtcatgactttatcatttcattaatatggagat
gacttctttccaggaactggataattgaattcagtagggttaggagtaggcagatattac
gcagttaatgtgccgttaaaaccagggatttcagatggaccttacttagatttgtttaag
aaagttacaagcagagtcatggagacttttcgtcctgattgcgttgttgtgtaatgtggt
gcagattcattatcactggatcgattaggagcactaaatttatccataaaaggacatgga
tagtgtattacctatatgaaataatttggagttccattgattcttttaggaggaggaggc
tataccatttagaatgtgtctagatgttgggcttacgagacagggttatgcttaggatag
aatattgacgagcctattccaactaatgatgtttactataaaaattatagcggggattat
catttacactttccaatccaagaacatgttgaaaacaaaaataaagctgaagatttaaac
aaaattgtatctcaagtgtatgatcatctgaaaaacttagaaaatgcaccaggaattcat
tttcatgatgttccttattcattctatccaaatatggatctggagaatgaagatgacaat
aaaataaacatggacatgaaacaagagatatctttaagcgaattggaataagaaatagga
gtatctgatgaagctaatgctatctcagttaattctggttctagaaaaatacattcaaaa
gaagtttga

DBGET integrated database retrieval system