KEGG   Paramecium tetraurelia: GSPATT00013163001
Entry
GSPATT00013163001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00190  Oxidative phosphorylation
ptm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GSPATT00013163001
Enzymes [BR:ptm01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     GSPATT00013163001
SSDB
Motif
Pfam: Rieske
Other DBs
NCBI-GeneID: 5030874
NCBI-ProteinID: XP_001445095
Genoscope: GSPATT00013163001
UniProt: A0D3T1
LinkDB
Position
undetermined
AA seq 260 aa
MISGALRRSFIGKAHFGLVSEYNSRVNQKLYKGVQVSEAPQFFTTSARPGNFGDHLDFKV
QMDNWFDENRVHNEHETEIKRTQIYALNAVYYGGLLSFARLFAVGIIGRLDGWKRYDRDT
YLEMDIGDLPPGEVMQIVWNGTPVFIRRLTQQEIKDEDNLPKETILDPSSEVVLTNCGNT
KVLVVSALCTHLGCIPIPYLGAYNGWVCICHGSVYDKYARVRQGPALQNLPFINNSIYDD
VIVCIEEMKFPREPSQRYWT
NT seq 783 nt   +upstreamnt  +downstreamnt
atgattagtggagcattgagaagatcgtttattggcaaagctcattttggtctagtttca
gaatacaatagcagagtcaactaaaagttatacaaaggagtttaagtatctgaagcaccg
caattcttcacaacatcggctagaccaggaaattttggtgatcatttagatttcaaagta
caaatggataattggtttgatgaaaacagagtgcataacgaacacgagactgaaattaaa
agaacataaatatatgcattaaatgccgtctattatggtggattgctctcctttgcaaga
ctatttgcagtggggataataggaagattggatggatggaagagatatgatagagacact
tatctcgaaatggatattggagatttacctcctggagaagtcatgtaaattgtttggaat
ggtacaccagtatttattaggagattaacttaataagaaataaaggatgaagataattta
ccaaaagagactattttggatcctagctctgaggttgtccttaccaattgtggtaatact
aaggtattggttgtcagtgctttatgcactcatttagggtgcataccaatcccatattta
ggtgcctacaatggttgggtttgtatttgccatggttcagtgtatgataaatatgcaaga
gtgagacaaggaccagctttgtagaatttgccatttatcaataactccatctatgatgat
gtgatcgtctgtatagaagaaatgaagttcccaagagaaccaagttaaagatattggact
tga

DBGET integrated database retrieval system