KEGG   Paramecium tetraurelia: GSPATT00018791001Help
Entry
GSPATT00018791001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00020  Citrate cycle (TCA cycle)
ptm00190  Oxidative phosphorylation
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSPATT00018791001
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GSPATT00018791001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GSPATT00018791001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_7 Fer4_10 Fer2 Fer4_18
Motif
Other DBs
NCBI-GeneID: 5037777
NCBI-ProteinID: XP_001451992
Genoscope: GSPATT00018791001
UniProt: A0DNH8
LinkDB All DBs
Position
undetermined
AA seq 212 aa AA seqDB search
MYLDALLYIKDNYDSSLSLRRSCREGICGSCSMNCNGLHKLACIHAIDTDLTQPAYITPL
GHMFVVKDLVVDMTNFYTQYKTIDPYLKRKSPKEGNKEYIQSVEDRKLLDGLYECVLCAC
CSTSCPSYWWHPDRYLGPAVLMQAYRWIVDSRDEYTDERLEKLAEDVKVEDCQNIGMCSF
TCPKGLDPQRSMNHLMKLIEEYKERKIASATL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtacttggatgcattgttatacattaaagacaattacgattcctcattatcattacgt
agatcctgcagagaaggcatctgtggatcttgctcaatgaattgcaatggtcttcataaa
ttggcttgtattcatgctattgacactgacttgacataaccagcctacatcactccattg
ggacacatgtttgtagtcaaagacttggtcgtcgacatgaccaatttctacactcaatat
aagacaatagatccatatttgaagaggaagagtccaaaagaaggaaataaggaatacatc
caatcagtggaagacagaaagttattggacggtctttacgagtgtgtgttgtgtgcatgc
tgttctacttcttgtccttcttattggtggcatccagatagatatcttggtccagctgtg
ttgatgtaggcttacagatggattgtggattcaagagatgagtacactgatgagagattg
gagaagttagctgaggatgtcaaggtggaggactgttagaatataggaatgtgttcattt
acatgtccaaagggattggatccacagagatcaatgaaccatttgatgaaattaatagaa
gaatacaaagaaagaaagattgcatctgcaacattatga

DBGET integrated database retrieval system