KEGG   Paramecium tetraurelia: GSPATT00020305001Help
Entry
GSPATT00020305001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00052  Galactose metabolism
ptm00500  Starch and sucrose metabolism
ptm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    GSPATT00020305001
   00500 Starch and sucrose metabolism
    GSPATT00020305001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptm04147]
    GSPATT00020305001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     GSPATT00020305001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSPATT00020305001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 5039815
NCBI-ProteinID: XP_001454030
Genoscope: GSPATT00020305001
UniProt: A0DUB6
LinkDB All DBs
Position
undetermined
AA seq 815 aa AA seqDB search
MLIIILLNLQVAVYTRYATTQVKNTVAFKQYKLYTSETSVFKAGHSINLEQNLILEIRQE
NIDQVDIQIYDEANKHFRIPSDPPFNYNDVKDPQQFNSYDYDIRVQFNPIVIQVQRDNAT
IFTITDLIFSETYIEFTHIPQNKQMWGLGERNQVGFRFKEGIYTLFARDEPNIIENGKRP
GKHVYSSHPVLLSMEESGKFNVMFYKTSSPMDVHYEEDKMKFITIGGIIHVKLFLGDTSP
RSAIKKYHKYLGGWMLPPFWGFGFHQCRWGYKNSSVLIDVVQQYQKNLIPIDIIWTDLDY
MDDRQIFSVDKHKFPKKDFQYLKGLGVRYIPLLDVAVGVKYGSEDEGYRKGTEYDVFLYS
PYTGYRFQGYVWPGDSYFPDFFHPNISKYWNEMHEHLYEQVEFDGLWVDMNEPANFCEGE
CDWNKLNNEIIFPYIPGQIPLANKTLPPHLLHHGQYLHKDVHNLYGIMDSYYTYQAQKEL
GKVQPFQITRSTFPGTGKYAQHWTGDNGASWDFLYLSLGQVFQFQIFGIPMVGADVCGFM
GDTNDKLCCRWIQLAFFYPFFRNHNNDLSKPQEFYNLGFHVIQSAQKNIHLRYTLLKWFY
SVFIREQNHGSIINPLFFIFPEDYLTYRDFVMDTQLLIGEELMGAPILEEGVTRIAYFPD
SNWYDLITGLELKGKQDHTLYCSYNEIVPIFLRSGYLVIQNTKEMIKNLKSLDNHYRIIA
APLNQEAKGVFADLDNFEDEEKALEAEIINIKLAVEEKSIKITISQSHSELLIDEILIYG
LECSYKQCTSGYYKYNSVFKGPFSLGQDKTELVLK
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgttaatcatcattttgttaaatttataagttgcagtatacacgcgttatgcaacaaca
caggtaaaaaatactgtagcctttaaataatataaactttatacaagtgagacctcagta
tttaaggcaggacattcaataaatttagaataaaatctcattttagaaatcagataagaa
aacattgattaagttgatattcaaatctatgatgaggcaaataaacactttagaatacca
tcagatcctcctttcaactataatgatgtgaaggatccttaataatttaattcttatgat
tatgacataagagtatagttcaatcctattgtgattcaagtacaaagagataatgctaca
atttttacaataactgatttaatctttagtgaaacatatattgaattcactcatattcca
caaaataaataaatgtggggtttgggagaaagaaattaagttggatttcgtttcaaagag
ggaatctacacattatttgcaagagacgaacccaatataatagaaaatggaaaacgacca
ggaaaacatgtatattctagtcaccccgttttattaagtatggaagaaagtgggaaattc
aatgtgatgttctacaaaacatcatctcccatggatgtgcattatgaagaggataaaatg
aaattcataaccataggtggaatcatccatgtaaaattatttttgggtgacacttctccc
agatctgcaattaaaaaatatcataaatatttgggtggttggatgctcccaccattttgg
ggatttggatttcatcaatgcagatggggatataaaaatagcagtgttttaatagatgtt
gtataatagtattagaaaaatcttataccaattgatataatctggactgatcttgactat
atggatgatagataaatattctcggttgataagcataaatttccaaagaaggacttttaa
tacttaaaagggttgggtgtcagatatattccattgttagatgtggctgttggagtgaaa
tatggaagtgaagatgaaggctacagaaagggaacagagtatgatgtttttttatattct
ccatatactggatatcgattttagggatatgtttggcctggcgattcctatttccctgat
ttctttcatccaaatatcagtaaatattggaatgagatgcatgaacatctatatgaataa
gtggaattcgatggtctatgggttgatatgaatgaaccagctaatttctgtgaaggagaa
tgtgattggaacaaattgaataatgaaatcatctttccatacatcccaggataaatacca
ttggctaataagacattgcctcctcatttgttacatcatggccaatatttacataaggat
gtacataatctctatggaatcatggattcttactatacttattaagctcaaaaagaattg
gggaaggtgcagccattccaaatcaccagatctacatttccaggtactggtaaatatgct
taacattggacaggagataatggagcatcatgggatttcctttatttatcgctgggacaa
gtattttaattttaaatattcggaattccaatggtcggagctgatgtttgtggctttatg
ggtgacacaaacgataagctctgttgtagatggatttagctggccttcttttaccccttt
ttcagaaaccataataatgatttatcgaaaccataagagttctacaatcttggctttcat
gttattcaatctgcttaaaaaaacatccatctcagatatacattattgaaatggttttat
tctgtttttattagagaataaaatcatggctcaataataaatcccttgtttttcatcttc
cctgaggactatcttacatacagagactttgtaatggacactcaattgttgataggagag
gagttgatgggtgccccaattctcgaagaaggagttactagaattgcatatttcccagat
tcgaactggtatgatctcattactggattggaattgaagggcaaataagatcatactctg
tattgttcatacaatgaaatagttccaatatttttaagaagtggatacctagtgatacaa
aatacaaaagaaatgattaaaaatcttaaatctttagataatcattatagaattattgca
gctccattaaaccaagaagcaaaaggagtattcgcagatttagataattttgaagatgaa
gaaaaggcacttgaagctgaaattattaatataaaattagcagttgaagagaagagtata
aagattacgatttcttaaagtcactcagaattattgatagatgagatattgatttacggt
ttagaatgttcatacaagtaatgcacgtctgggtattataaatacaactcagtattcaaa
ggtccatttagtttgggacaagataaaacagaattagtgctaaaatga

DBGET integrated database retrieval system