KEGG   Paramecium tetraurelia: GSPATT00026295001Help
Entry
GSPATT00026295001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00562  Inositol phosphate metabolism
ptm01100  Metabolic pathways
ptm04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GSPATT00026295001
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    GSPATT00026295001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptm01009]
    GSPATT00026295001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     GSPATT00026295001
    3.1.3.48  protein-tyrosine-phosphatase
     GSPATT00026295001
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     GSPATT00026295001
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    GSPATT00026295001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 Y_phosphatase2 PTP2 PEX-1N CDKN3 Cullin_Nedd8
Motif
Other DBs
NCBI-GeneID: 5047130
NCBI-ProteinID: XP_001461345
Genoscope: GSPATT00026295001
UniProt: A0EF81
LinkDB All DBs
Position
undetermined
AA seq 411 aa AA seqDB search
MISMHNIEDTTSLNRISSDEDEYLESPLNIQKVQEIEQQSLQQCDEEVPISETPIERSFN
RHIDERINDTAVLQNHANEITQKIMKNVKCAFQREIIKELVSKSKKRFKLDGFNLDLTYV
TDSLIAMGFPAENFEAIYRNSMSEVQKFLNTRHPSNYMVINLCSERKYKHESFFKVAEFP
FDDHQAPPFTLIVDFCTAVHDWLTQDPNHVIAVHCKAGKGRTGVMICCYLLYSGKYTSSQ
DALAYYGLVRTLNQKGVTIPSQIRYVHYFSFALKNDLIKRPFLQVELLSVRLVGSAHGSL
IRLQNNSKQLIEKAQIISEKEIIFTFDGIYLQGDVLLQIFQKSIVSESKILQIWFNTNFV
SLSPNEQVFKASEIDIMKKSKKKHSSNMQLELLLNKTVEIRQRSNCFSKGI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaatgcataatatagaggacacaacgtcccttaatcggatatccagtgatgag
gatgaatatttagaaagtccgttaaacattcagaaggttcaagagatcgaataacaaagt
ctttaataatgtgatgaggaagtgccaatcagcgaaacaccaatagagagaagtttcaac
agacacattgatgagagaataaacgatactgcggtgttgcaaaatcatgcgaatgaaatc
acataaaagattatgaaaaatgttaagtgtgcattttaaagggaaattataaaggaacta
gtatctaaatcgaagaaaagatttaaattggatggttttaatttggatttgacttatgtt
actgatagtctgattgcaatgggatttcctgcggagaattttgaggctatctatcgaaat
tccatgtctgaagtctaaaaattcttaaatacacgtcatcccagcaattatatggtcata
aatttatgttcagaaagaaagtataagcacgaatcattctttaaagtggctgaatttccc
tttgatgatcatcaggcacctcctttcactctgatagttgatttctgtacagcagtgcac
gattggctgacataagatccaaatcatgtgattgcagttcattgcaaggctggtaaaggg
agaacaggagtgatgatttgctgctatttgctgtacagtggtaagtacacatcaagtcaa
gatgccttggcttattatggattagttcgaactttgaattagaaaggcgttaccattccc
agttagattaggtatgtgcattattttagttttgccttgaaaaacgatttaatcaagaga
ccatttctgcaggtcgagttgctttcagttcgtttggttggttcagctcatggatctttg
attcgattgcagaacaacagcaaataattgatagaaaaggcttagattatttcggagaag
gaaatcatttttacttttgatggcatatatcttcaaggagacgttctattataaatattc
taaaaatcaattgtctcggaatcaaaaatcttacaaatttggttcaatacaaactttgtc
tctctatccccaaacgaataggtatttaaagcctccgaaattgacattatgaagaaatca
aaaaagaaacactcctcgaacatgcaattagagttgttactgaataaaacagtagaaatc
agacaaagatcaaattgtttttctaaaggtatatga

DBGET integrated database retrieval system