KEGG   Paramecium tetraurelia: GSPATT00028549001Help
Entry
GSPATT00028549001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K09540  translocation protein SEC63
Organism
ptm  Paramecium tetraurelia
Pathway
ptm03060  Protein export
ptm04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    GSPATT00028549001
   04141 Protein processing in endoplasmic reticulum
    GSPATT00028549001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ptm03110]
    GSPATT00028549001
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ptm02044]
    GSPATT00028549001
Chaperones and folding catalysts [BR:ptm03110]
 Heat shock proteins
  HSP40 / DNAJ
   GSPATT00028549001
Secretion system [BR:ptm02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   GSPATT00028549001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ Sec63 DUF2207 E2F_TDP Ly49
Motif
Other DBs
NCBI-GeneID: 5010696
NCBI-ProteinID: XP_001424912
Genoscope: GSPATT00028549001
UniProt: A0BG47
LinkDB All DBs
Position
undetermined
AA seq 648 aa AA seqDB search
MGFKEAFTRQGDGENLLFDDDAFIYFAISILTLVILPLVYSVIKPLFTTYVLGENKRKLA
RVPKSGNDQLNLQLAKQELKLKWLTTGYVFKIIILVALLLMLNASIQSLPNAEKIKGFDP
YEILEIDPTATEQEIRKAYRKISLKLHPDKNPDDPQANQKFILLTKAYECLTDEDKKSLC
MKYGNPDGQQSLSVGIAMPSFLLKKENRAAFLAVIFLLLLVVVPIIVLYELRSIGKYDQN
GVMLSNQEKFERGLEENLLIKKGVELSSCSDELCRLRLKSEQQAIDLEKLVNELKEEAEL
RKIQKFEITEALEQSKKQKNKKRRVTISVAMILIYAHLFGKPIPQSVISLYRSTIKIIPK
LVNSMVRLAFEFSMKYKVIQWRQRGRFQTKFMGARCINNILQFSQCIVQGIYETDNPINQ
IEFFATKAKDYIKKGKMPVFQELVQKQVDQRVLPSWVPEEFKDEIMKEINMFPQLDIKPE
VTVDDESIVEQCNEDIFSIKITLTRMNTPEGEDIPFAHSNRFTYVKEEGWHILITFQNEV
FYYAFLNGSNREQSTEFKFQPKMYFGDIVEFEFVLFVISDCYRGLDSEIPIKFKAKKASQ
ISRAVEYHKEDQELDKSLPFIQSMLFPMQNKVEDSDSEDEDQSKKDDE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgggatttaaggaagctttcacgagacaaggcgatggagagaatctgctcttcgatgat
gatgcattcatctatttcgctatttccattcttactttggttattcttcctctggtctac
tcagttatcaagccactgttcacaacatacgtgttgggtgaaaataaaagaaaattagca
cgtgttcccaaaagcggcaatgatcaactcaatctacaattggctaaataggaattgaaa
ttgaaatggcttacaacaggttatgtgtttaagatcataatacttgtggctctattgcta
atgctcaatgcatccatttaatctttgccaaatgcagaaaaaatcaaagggtttgatcct
tatgagattttagaaatcgatccaactgctacagaataggaaattcgtaaagcatataga
aaaatttcattaaaattgcatccagataaaaatcctgatgatccttaagcaaatcaaaaa
tttatccttctcaccaaagcatatgaatgtttaacagatgaagacaaaaaatccttatgc
atgaaatatggaaatccagatggacaataaagtttatctgttggtatagcaatgccatca
tttctattaaaaaaagaaaatagggctgcctttttagctgtaattttccttttgcttttg
gttgttgtaccaataattgttttgtacgagttgagatcaataggaaaatatgattaaaat
ggagtcatgcttagtaatcaggagaaatttgaacgagggttggaagagaacttattaatc
aagaaaggagtagaattatctagttgcagtgatgaattatgtagattaagattgaaatcc
gaataataagctattgacttagagaaattagttaatgaattgaaagaagaagctgaattg
agaaaaatctaaaaatttgaaataaccgaagcacttgaatagtcgaaaaaataaaagaat
aaaaaaagaagagtgaccatctctgttgccatgattctaatctatgcccatttatttggt
aaacccattccttaaagtgttatatctttatatagatctactattaagataattccaaaa
ttagtcaactcaatggtaagattggcatttgaattctctatgaaatacaaagtaatccaa
tggagacaaagaggaagattttaaactaaatttatgggtgcaagatgcattaataacata
ttacaattctctcaatgcatagtctaaggcatatatgaaacagataatccaattaattaa
attgagttttttgctacaaaagccaaagattatattaaaaaaggaaagatgccagtgttt
caagaattagttcaaaaataagtggattagagagtgttaccaagttgggtgccagaggaa
ttcaaagatgaaattatgaaggaaatcaatatgttcccataattagatatcaaacctgaa
gtgacagttgatgatgaatctattgtggaataatgtaatgaagatatctttagtattaaa
ataactttaacaagaatgaacactcccgaaggagaagacattccatttgctcattccaat
agatttacttatgtaaaggaggagggatggcatattttaataacattttaaaacgaagtg
ttttattatgcttttttgaatggttcgaatagagaacaatcaacagaattcaaattctaa
ccaaaaatgtattttggagatatagttgaatttgaattcgttctattcgtcatatctgat
tgttacagaggattggattctgaaataccaattaaatttaaagccaaaaaagctagctaa
ataagcagagctgttgaataccataaggaagattaagaattggataagtcacttccattt
attcaatcgatgttattccccatgtaaaataaagtcgaggatagtgattcagaagatgaa
gatcaatcaaagaaagatgatgaatga

DBGET integrated database retrieval system