KEGG   Paramecium tetraurelia: GSPATT00029759001Help
Entry
GSPATT00029759001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm01040  Biosynthesis of unsaturated fatty acids
ptm01100  Metabolic pathways
ptm01212  Fatty acid metabolism
ptm04146  Peroxisome
Module
ptm_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GSPATT00029759001
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    GSPATT00029759001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     GSPATT00029759001
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     GSPATT00029759001
    4.2.1.119  enoyl-CoA hydratase 2
     GSPATT00029759001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 SCP2 KR Alkyl_sulf_C THF_DHG_CYH_C
Motif
Other DBs
NCBI-GeneID: 5012310
NCBI-ProteinID: XP_001426526
Genoscope: GSPATT00029759001
UniProt: A0BKR1
LinkDB All DBs
Position
undetermined
AA seq 439 aa AA seqDB search
MSQLRFDGKVVVITGAGNGLGKEYALFFGKRGAKVVVNDLGGSMKGTGASSSAADKVVDE
IKAAGGVAVANYDSVEFGEKVIDTAIKAFGKIDILINNAGILRDVSFEKMKDEDWDLIYR
VHLKGTYSCTKAAWPYMREQKYGRIINTSSASGVYGVFGQNKLLCCQDGEGLKRNILVNS
ICPVAASRLTETVMSKELLANLKPEFVVPLVGVLSHDDSKETGAIYELGAGYISKLRWQR
NQGYFFDTPFTPEDVRDKWEQVAGFGDNVCYPQTSSEIFEIFFNKEDFIKQQKEGKTSTA
QTQQTTQAPSVNLKADKIFGLMKAFLDRGEGKEFIPKIQGVFNFEIITQKGGPVVKSWVI
DLKNGQGGIKEGKESADATFTMIDDDFEKVCLGKLQANEAFLKGQMKIKGNMKKATLFTP
SLFPAPTPDNLAKYSQPKL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagttaattgagatttgatggtaaagttgtcgttatcactggagctggtaatggctta
ggaaaggagtacgcattattttttggaaaaagaggagcaaaagtcgttgttaatgattta
ggaggttcaatgaaaggtacaggagcttcatcttctgctgctgataaagttgttgatgaa
attaaagctgctggtggagttgctgtcgccaattatgatagtgttgaatttggagagaaa
gtgattgacactgcaattaaggcatttggaaaaattgatattttaataaacaacgctggt
attctaagagatgtttcatttgaaaaaatgaaagatgaagattgggatctcatttataga
gttcatttaaaaggcacatactcttgcactaaagctgcttggccatacatgagagaataa
aagtatggaagaatcattaacacatcttcagcctctggtgtttatggtgtctttggttaa
aacaaattattgtgctgccaagatggagaaggattgaagagaaatattttagttaattca
atctgtcctgtagctgcaagtagattgactgagactgttatgagcaaagaattacttgca
aatttaaagccagaatttgttgtaccacttgtaggtgtgttgagtcatgatgattcaaaa
gaaacaggtgcaatttatgaattgggagctggatacatttctaaattgagatggtaaaga
aatcaaggctatttctttgacacaccattcacccctgaagatgttagagataaatgggaa
taagtagctggttttggagataatgtttgctatccttaaacatcatcagagatctttgaa
atctttttcaataaggaagatttcattaaataatagaaagaaggaaaaacatcaacagct
taaacataataaactacacaagctccaagtgttaatctaaaagcagacaagatttttggt
ttaatgaaagcattcttggatagaggagaaggaaaagaattcattcctaaaatttaagga
gttttcaattttgaaattatcacataaaaaggtggaccagtggtaaaatcctgggtgatt
gatctaaagaatggtcaaggaggaataaaggaaggaaaagaatcagctgatgccactttc
acaatgattgatgatgattttgaaaaggtttgcttaggaaaattgtaagccaatgaagca
ttcttaaaaggacaaatgaagatcaagggaaatatgaagaaagcaactctattcacacct
agtttattcccagcaccaactccagataaccttgctaagtattcctaaccaaaattatga

DBGET integrated database retrieval system