KEGG   Paramecium tetraurelia: GSPATT00035998001Help
Entry
GSPATT00035998001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00020  Citrate cycle (TCA cycle)
ptm00190  Oxidative phosphorylation
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSPATT00035998001
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GSPATT00035998001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GSPATT00035998001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 5020049
NCBI-ProteinID: XP_001434264
Genoscope: GSPATT00035998001
UniProt: A0C7V0
LinkDB All DBs
Position
undetermined
AA seq 636 aa AA seqDB search
MFRITTQALYNLQATKLVNRFCVVSKNKPEAGPSQGHLTDKYTVIDHTYDAVVVGAGGAG
LRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWL
GDQDAISYMCKEAPKAVYELESYGLPFSRTPEGKIYQRAFGGQSLKFGTGGQAYRCCAVA
DRTGHAMLHTLFGRALGYDCIFFVEYFALDLMMDDQGACRGVVCMSMADGSIHRIRAGYT
VIATGGYGRAFQSCTSAHTCTGDGGGMTIRAGLPMEDLEFVQFHPTGIYGSGCLMTEGCR
GEGGILRNSLGERFMERYAPTAKDLASRDVVSRAMTKEILEGRGVGPEKDHIHLHLNHLP
AELLHERLPGISEAAKIFAGVDVTKEPAPVLPTVHYNMGGIPTNFKTEVLNQVAGKDQVV
PGLLAAGEAACASVHGANRLGANSLLDIVVFGRQAANLVGEKWKPGQKQPDLPKNAGEAA
IARIDRLRHHEGSQTVAQVRKDLQRTMQKHAAVFRIEKTLQEGVEKVKEIYSRKDDIRIK
DKGLVWNSDLVEGLELDNLLLQGKMTIEGALNRKESRGAHARDDFPDRDDKNWMKHTLAR
IKDAKKGDIELTYRDVITKTQDPKEFDTVPPKKRVY
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaattacaacttaggctttgtacaatctataggcgacaaagttagttaatcga
ttctgtgtggtgtcaaaaaacaaaccagaagctggtccttcttaaggccatttgacagac
aaatatacagtgatagatcacacatatgatgcagtagttgtaggagcaggtggtgctggt
ttaagagctgcatttggtttggttgagcttgggttcaagactgcttgtatttccaagttg
tttcccactagatctcatacagtggcagctcaaggaggtattaatgcagcattgggaaac
atgacagaagatgattggagatggcatgcatacgatacaataaagggatcagattggttg
ggagactaggatgctatctcttatatgtgcaaagaagcaccaaaggctgtttatgaattg
gaaagttatggtttaccattttcaagaactccagaaggcaagatctatcaaagagcattc
ggaggacagagtttgaaattcggaacaggaggacaggcctatagatgttgtgcagtagca
gacagaacaggacatgctatgttacacactttgttcggaagagccttgggatatgattgt
atattcttcgtggagtacttcgctcttgatttgatgatggatgatcaaggagcttgcaga
ggagtagtatgcatgtcgatggcagatggctcaattcacaggattagagcaggatacaca
gtgatagcaactggtggttatggtagagcattttaatcgtgcacatctgcccatacttgc
acaggtgatggtggaggtatgactatcagagcaggtttaccaatggaggatttggaattc
gtataatttcatcctactggtatttatggttctggatgtttgatgactgaaggatgcaga
ggagaaggtggtatcctcagaaattctttgggagaaagattcatggagagatacgctcct
actgctaaggatttggcaagtagagatgttgtgtctagagctatgactaaggaaatttta
gagggaagaggagttggaccagaaaaggatcacatccatttgcatctcaatcatttgcct
gctgaactcttgcatgaaagattaccaggaatcagtgaagccgctaaaatatttgcaggt
gtcgatgtcacaaaagaacctgcaccagtcttacctactgttcattacaatatgggtgga
atacctaccaatttcaaaactgaagttcttaatcaagttgcaggcaaagatcaagtggtg
cctggacttttggcagctggtgaagctgcttgtgcatcagtccatggtgccaatagattg
ggagccaattccttattagatatcgttgtttttggaagacaggctgccaatcttgtaggt
gaaaagtggaaacctggatagaaacaaccagatttacctaaaaatgctggagaagctgcc
atcgccagaatcgacagattaagacatcatgaaggatctcagactgttgcttaagtcaga
aaggatctccaaagaactatgcaaaaacatgctgctgtctttagaattgagaaaacattg
taggaaggtgttgaaaaagtcaaagaaatctattccagaaaagatgatatcagaatcaaa
gacaaaggacttgtatggaattctgatttggtagaaggattagaattagacaatttacta
ttgtaaggcaaaatgaccatagaaggtgctttaaatagaaaggaatccagaggagctcat
gctcgtgatgacttcccagatagagatgacaagaactggatgaaacatacattagccaga
atcaaagacgccaagaaaggtgatattgaactaacttatagagatgttatcactaagacc
taagatccaaaagaatttgataccgttcctccaaaaaagagagtgtattga

DBGET integrated database retrieval system