KEGG   Pseudoalteromonas translucida: PTRA_a0589Help
Entry
PTRA_a0589        CDS       T04220                                 

Definition
(GenBank) hypothetical protein
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PTRA_a0589
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptn01002]
    PTRA_a0589
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ptn01011]
    PTRA_a0589
Enzymes [BR:ptn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PTRA_a0589
Peptidases [BR:ptn01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   PTRA_a0589
Peptidoglycan biosynthesis and degradation proteins [BR:ptn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PTRA_a0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ALS31933
UniProt: A0A0U2V1C1
LinkDB All DBs
Position
I:580236..581897
Genome map
AA seq 553 aa AA seqDB search
MYLYLKNKNYYSINKLLIVALSFMLGACSSSVEPLEPKALLTQSKLVELPNAQVIVTFPE
PNPSSREYVNNRGTFKAYKGHGQLLIQNHSAKSADIYINNQLLNIKQLLGANTVYQYSLA
KLTHNGVNTFKVANIQPAGASLTLRFAFPTLNKASHQQANFSEVDALIERDIKAGFPGAV
LAVVKNGELIKLTAYGDAKQYQQNDLMLLRPEPMQTDTLFDLASNTKIFATNFALMKLVS
EGLLNINKPVQLYLPEYQGDGREQRRVKDLLTHSAGYPPVFDFHRKDSSNGDVFYSQNSH
TTKKLLLTSVPLSTKSLGQHVYSDIDYMILGVLVERITGLSLDDYLEQQVYAPLRLHNTV
FNPLKKGFNAQQFAATELGGNTRDGRVKFDNIRTHVLQGQVHDERAYYSLGGVAGHAGLF
SNAPDLAILCQLLLNNGGYGDKQLFSASALAQFLTPQSSDETYGLGFRLAGNNQARRWHF
GPYASAQAYGHTGWTGTVTVIDPVYDLAIVLLTNARHTPITGSQKSYQFSGKNYETAQYG
SVVSLIYEALLNQ
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtacttatatttaaaaaataaaaattattacagtataaataagctattaatagtggct
ttaagttttatgctgggtgcatgcagttcttctgtagagccgctcgaacccaaggcgcta
ttaacgcaaagtaaacttgttgagttgcctaatgcgcaagtgattgttacctttcctgag
ccaaaccccagtagccgtgagtatgtaaataatcgtggcacgtttaaagcttataaaggc
catggtcagctgttaatacaaaaccatagtgctaaaagtgccgatatttatataaacaat
caactgcttaacattaaacagttgctcggcgctaatactgtgtaccaatatagtttggct
aagctaacgcataacggggttaacacctttaaagttgcaaacattcaacctgctggggca
agcttaacgctgcgctttgcgtttcctactttaaataaagcatcgcatcaacaggctaat
tttagtgaggtagatgcattaatagaacgtgacattaaagcgggttttcctggtgctgtt
ttagcggtagtaaaaaatggtgagttaattaaattaactgcttatggcgatgcaaaacag
tatcaacaaaatgatttaatgctattacgcccagagccaatgcaaaccgataccttattt
gacttagcctctaataccaaaatatttgctaccaactttgcattaatgaagttagtaagc
gaaggcctattaaatattaataagccagtgcaattatatttaccagaatatcaaggtgat
ggacgagagcagcgacgcgtaaaagatttactcacgcatagcgcaggttatccaccggtg
tttgattttcatcgtaaagacagtagcaatggcgatgtgttttactcacaaaatagccat
actacaaaaaagctcttacttaccagtgtgccacttagcacaaaatcactcgggcagcat
gtttattcagacattgattacatgattttaggagtattggttgagcgtattactggcctt
tcacttgacgattacctagaacaacaagtatatgcgccattaagattgcataacacggta
ttcaatccccttaaaaaaggctttaatgctcagcaatttgccgccactgagcttggtggt
aacacgcgggacggacgagtcaaatttgataatattcgcacccatgttttacaaggtcaa
gtgcatgacgagcgtgcgtactattctcttggtggcgtagcagggcacgcggggttattt
agtaatgccccagatttagccattctttgtcagctactattaaataatggtggttacggc
gataagcagctttttagtgcaagtgctttggcgcagtttttaactccacaaagtagcgat
gaaacctacggactgggctttaggcttgctggtaataaccaagcaaggcgttggcacttt
ggcccttacgcaagcgcacaggcctatgggcatacaggttggactgggacagtaacggta
attgatcccgtttacgacttagccattgttttattaactaatgcgcggcatacgccaatt
acaggctcgcaaaaaagttatcaatttagtggtaaaaattatgaaactgcacaatatgga
tcggttgtttcattaatatacgaagcgttattaaatcaataa

DBGET integrated database retrieval system