KEGG   Pseudoalteromonas translucida: PTRA_a1112Help
Entry
PTRA_a1112        CDS       T04220                                 

Gene name
fadJ
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn00071  Fatty acid degradation
ptn00280  Valine, leucine and isoleucine degradation
ptn00281  Geraniol degradation
ptn00310  Lysine degradation
ptn00362  Benzoate degradation
ptn00380  Tryptophan metabolism
ptn00410  beta-Alanine metabolism
ptn00640  Propanoate metabolism
ptn00650  Butanoate metabolism
ptn00903  Limonene and pinene degradation
ptn00930  Caprolactam degradation
ptn01100  Metabolic pathways
ptn01110  Biosynthesis of secondary metabolites
ptn01120  Microbial metabolism in diverse environments
ptn01130  Biosynthesis of antibiotics
ptn01200  Carbon metabolism
ptn01212  Fatty acid metabolism
Module
ptn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PTRA_a1112 (fadJ)
   00650 Butanoate metabolism
    PTRA_a1112 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PTRA_a1112 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PTRA_a1112 (fadJ)
   00310 Lysine degradation
    PTRA_a1112 (fadJ)
   00380 Tryptophan metabolism
    PTRA_a1112 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PTRA_a1112 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PTRA_a1112 (fadJ)
   00281 Geraniol degradation
    PTRA_a1112 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PTRA_a1112 (fadJ)
   00930 Caprolactam degradation
    PTRA_a1112 (fadJ)
Enzymes [BR:ptn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PTRA_a1112 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PTRA_a1112 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PTRA_a1112 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 Phage_portal
Motif
Other DBs
NCBI-ProteinID: ALS32374
UniProt: A0A0U2LLL5
LinkDB All DBs
Position
I:1043682..1045871
Genome map
AA seq 729 aa AA seqDB search
MSDSVFNLTVDENKIAVVTIDVQGEKMNTLRSSFADDLKALLAEAKQQSVKGMVFISGKS
DNFIAGADVKMLDSVQKREDALAISELCHHAFFDMENLPFTTVSAIHGAALGGGLEFALA
CDYRVGTDSGITIIGLPEVQLGLLPGGGGTQRLTKIIGIQKGLEWMLTGKQIRAQQAKKA
GVLDDCVPHSVLLKVAKEFAAKGKAPTKEPKLDTVSKLLESNPFGRNFIFKKAKENVIKQ
TGGHYPAPLLIIKAVRASVELDKLKAYKTEAESFATLVMSDESKALRSVFFATTEMKKDW
RNGDAPAINKTAVLGGGLMGAGIAHVSAVKAKVPVRIKDVAEQGISNAMSYTYKILDKRL
KRRIMSKADMQLTMSRITGATDYSGFKNIDLVIEAVFEDLELKQGMVADIERECQENTIF
ASNTSSLPISQIAAQAQRPENVIGLHYFSPVEKMPLVEIIPHAGTSKETITRVVNFARKQ
GKTPIVVKDTAGFYVNRILAPYLNEAANLMLAGEPIEKIDAALVEFGFPVGPLALLDEVG
IDIGSKIAPILEKELGERFKAPDAFTRMIESKRLGRKTGHGFYEYDKKGKKVDESIYELL
NVTPAPRLNKSEIAKRCIAQMLNEAVRCLDEGIIASPRDGDIGAIFGIGFPPFFGGPFSY
MDKLGASKISSDMSTLGSSNAIFTPCDTLVAMAESGAKFYAAQPSTEPTGESEPAEQATD
DAAAPSAKE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattcagtatttaatttaacggttgatgaaaataaaatcgccgtagtaactata
gatgtgcagggcgaaaaaatgaataccctgcgcagtagttttgccgatgatttaaaagcc
ttactagccgaagctaagcagcagtctgtaaaaggcatggtatttattagtggtaaaagt
gataactttattgctggcgctgacgttaaaatgcttgatagtgtgcaaaagcgtgaagat
gctttagctattagcgagttatgtcatcatgcattttttgacatggaaaacctgcctttt
actacggttagtgctattcatggtgcagctttaggtggcggattagagtttgcattagcc
tgtgattaccgcgtaggcaccgacagtggcattactataattggtttgccagaagtgcaa
ttaggtttattacctggtggcggcggtactcagcgtttaactaaaataattggtattcaa
aaaggcttagaatggatgctaaccggtaagcaaattcgtgcacagcaagctaaaaaagcc
ggtgtattagatgattgcgtaccacatagcgtgctattaaaagtagcgaaagaatttgct
gctaaaggcaaagcaccaactaaagagccaaaactcgacaccgtgagcaagctgctagag
tcaaacccgtttggtcgtaactttatctttaaaaaagcaaaagaaaacgtcattaaacaa
acgggcggacattaccctgcgccacttttaattattaaagcagtacgtgcaagcgtagag
ctcgataagctaaaagcgtataaaaccgaagctgaaagctttgcaacgctggtaatgagc
gacgaatcaaaagcgctgcgcagtgtgttttttgcaaccacagaaatgaagaaagactgg
cgcaacggtgacgcaccagcaattaacaaaaccgcagtgttaggtggcggactaatgggc
gcaggtattgcgcacgtaagtgccgttaaagctaaagtaccggtacgtattaaagatgta
gcagagcagggcattagtaatgcaatgagctacacctataaaattttagataagcgctta
aagcgccgtattatgtctaaagccgatatgcagctaacaatgagccgtattacaggcgct
accgattacagcggttttaaaaatatagatttagtaattgaagcggtatttgaagatctt
gagcttaaacaaggcatggttgctgatatagagcgtgaatgccaagaaaatactattttt
gcgagtaatacctcgtcattacctatttcgcaaattgcagctcaagctcagcgccctgaa
aacgtgattggtttacattacttttcaccagtagaaaaaatgccactggtagaaattatt
ccacacgccggcacctcaaaagagaccattactcgtgtggtaaactttgcgcgcaagcaa
ggtaaaacacctattgtagtaaaagataccgctggcttttatgtaaaccgtattttagcg
ccttacttaaacgaagcagctaacttaatgctagcaggcgagccaattgaaaaaattgat
gcagctttagttgagtttggttttccggtaggcccactggcattacttgatgaagtaggt
attgatattggttctaaaattgcgccaattttagaaaaagagctaggcgagcgttttaaa
gcacccgatgcatttactcgtatgatagagtcaaaacgccttggtcgtaaaactggtcat
ggcttttatgagtacgataaaaaaggcaaaaaggttgacgagtcaatttacgaactactt
aacgttaccccagctccgcgtttaaataaaagcgaaattgccaaacgttgtattgcacaa
atgcttaatgaagcggttcgttgtttagacgaaggcattattgccagcccgcgtgatggt
gatattggtgctatttttggtattggttttccaccgttcttcggcggaccatttagctat
atggataaactaggcgcaagtaaaataagctcagatatgtctacattaggcagtagcaat
gcaatttttactccttgcgacacccttgtagcaatggcagagtcaggcgctaagttttat
gccgctcagccaagcacagagccaacaggtgagtcagagcctgcagagcaagccactgac
gatgctgcagcgccaagtgctaaagaataa

DBGET integrated database retrieval system