KEGG   Pseudoalteromonas translucida: PTRA_a2488Help
Entry
PTRA_a2488        CDS       T04220                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn00061  Fatty acid biosynthesis
ptn00780  Biotin metabolism
ptn01100  Metabolic pathways
ptn01212  Fatty acid metabolism
Module
ptn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PTRA_a2488 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PTRA_a2488 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ptn01004]
    PTRA_a2488 (fabZ)
Enzymes [BR:ptn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PTRA_a2488 (fabZ)
Lipid biosynthesis proteins [BR:ptn01004]
 Fatty acid synthase
  Component type
   PTRA_a2488 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ALS33573
UniProt: A0A0U2VJF9
LinkDB All DBs
Position
I:complement(2336792..2337244)
Genome map
AA seq 150 aa AA seqDB search
MANELNSLDIQEILSLLPHRYPMLLVDRVIDFIPGKSLHAIKNVTINEPIFTGHFPNQPI
FPGVLILEAMAQATGLLGFKTVENRSENELYLFAAVDNARFKKPVLPGDTMHLHVEFLKE
RRNLWKFAAEAKVDGKLVCSAEIMCARREF
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaacgaattaaatagccttgatattcaagaaattttaagtttattaccgcatcgc
tacccgatgttattagttgatagagtaattgactttatacctggaaaatctttgcatgct
attaaaaatgtgactataaatgaacccatttttaccgggcatttcccaaatcagccaatt
tttccgggtgtactaatattagaagccatggctcaagcaactgggttacttggctttaaa
acggttgaaaaccgtagcgaaaatgaattgtatttgtttgcagctgtagataatgcacgt
tttaaaaaaccagtacttcctggtgatactatgcatttacatgttgagtttttaaaagaa
cgtcgtaatttatggaagtttgcagcagaagcaaaagtcgatggcaagctagtatgtagc
gccgaaattatgtgtgcgagaagagagttttaa

DBGET integrated database retrieval system