KEGG   Pseudoalteromonas translucida: PTRA_a2778Help
Entry
PTRA_a2778        CDS       T04220                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn00250  Alanine, aspartate and glutamate metabolism
ptn00410  beta-Alanine metabolism
ptn00430  Taurine and hypotaurine metabolism
ptn00650  Butanoate metabolism
ptn01100  Metabolic pathways
ptn01110  Biosynthesis of secondary metabolites
ptn01120  Microbial metabolism in diverse environments
ptn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PTRA_a2778 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTRA_a2778 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PTRA_a2778 (gadB)
   00430 Taurine and hypotaurine metabolism
    PTRA_a2778 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PTRA_a2778 (gadB)
Enzymes [BR:ptn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PTRA_a2778 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ALS33832
UniProt: A0A0U2WZL2
LinkDB All DBs
Position
I:complement(2623062..2624687)
Genome map
AA seq 541 aa AA seqDB search
MDQKRFAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAMIPEDPTFVSAYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGQQDEFYAKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKPDGNFKGIGAQGLIAGMMHYGYKGLAILISERGHYSLGKAADLLGIGRENL
VGIKTCENNKVDVNAMREKALELEAQGIKVMAIIGVAGTTETGNIDPLEAMADLAQDINC
HFHVDAAWGGATLLSNTHRHLLKGVERADSITIDAHKQMYVPMGAGLVLFKDPTATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKAHYFANLI
KADEDFELISEPELCLLTYRYVPKQIKQAIADADPQTRIDIFASLNRFTASMQKRQRESG
RSFVSRTRLTPTQYDNQPTVVFRVVLANPLTSGVILKEILAEQKELAKTDPVFKKYLSKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttttgccgtcgcctctaaagaaagccttaagcgtatatttactgta
cctgaagcgccagactcaactttaagcaaaatagagcttgaaatatcgagtaatttagca
ggttttttaaacgaaaacattgcggcaattgaaaaaccattacacgaaattgaaaaagac
tttcagtcggcgatgatcccagaagatccaacgtttgtatctgcttatgcgcaagatata
atggagcagttggttgcgcactctgtgcataccgcagcgcctagctttattggccatatg
acttctgctttgcctcattttttactaccattatcaaagttaatggtagggctaaatcaa
aacctagtaaaaatagaaacctctaaagcttttactccacttgagcgccaagtgcttgga
atgatgcatcatttagcgtacgggcaacaagacgagttttatgctaaatggatgcacagt
gcaaaaacatcgttaggtgcattttgctcaggcggtactgtagctaatattacggcgctt
tggattgcgcgaaataggttattaaaacccgatggcaactttaaaggtataggcgcacaa
ggcttaattgccggtatgatgcattacggctataaagggttggctattttaatttctgag
cgtggccattattcgttaggtaaagcggctgatttattaggaattggtcgtgaaaactta
gtgggtattaaaacatgcgaaaacaataaagttgatgttaacgccatgcgcgaaaaagcc
ttagagcttgaagcgcaaggtattaaagtaatggccattattggagtcgcgggtaccaca
gaaaccggtaatatcgatccccttgaagcgatggcagatttagcacaagacattaattgc
cactttcatgttgacgctgcatggggcggggcaactttgttatctaatacccatcgccat
ttactcaaaggtgttgagcgcgcagactcaattaccattgatgcacacaaacaaatgtat
gttcctatgggagctggcctggtgttgtttaaagatccaaccgctaccgatgcaattgaa
catcatgcagagtatattttacgtaaaggttcaaaagatttaggtagccatacacttgag
ggcagccgcccgggtatggcaatgttagtacatgcttgcttacgtgttattggccgtaaa
ggctacgaaatgctaatcgatcgtagtattaaaaaagcccattactttgctaatttaatt
aaagcagatgaagattttgagctgatctcagagccagagctgtgcttattaacgtatcgt
tatgtgcctaagcaaataaagcaggcaattgcagatgctgatccgcaaacacggattgat
atttttgcctcacttaatcgctttactgcaagtatgcaaaaacggcaacgtgaatcaggg
cgatcatttgtatcacgtacgcgtttaacgcctactcaatacgataatcagcccacagtg
gtatttagggtagtacttgctaacccacttacatcaggcgttattttaaaagaaatttta
gcagaacagaaagagttggctaaaacagatccggtatttaaaaagtacttaagtaagtat
atgtaa

DBGET integrated database retrieval system