KEGG   Pseudoalteromonas translucida: PTRA_a3036Help
Entry
PTRA_a3036        CDS       T04220                                 

Definition
(GenBank) membrane protein
  KO
K07058  membrane protein
Organism
ptn  Pseudoalteromonas translucida
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    PTRA_a3036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ALS34060
UniProt: A0A0U2V8P6
LinkDB All DBs
Position
I:complement(2861366..2862325)
Genome map
AA seq 319 aa AA seqDB search
MSDVKRGQDAQQPVNIPLLGWWDITKRIFTQLSRDNLSLVAAGVAFYALLAIFPALAALV
SVYAYFASPTDIGAHLSQVIALLPESTGELILSQIASIAQKSGTSLSLSAISTLILTIWS
SSKGSQALITACNISYQEYEKRSFFKAQLVRFLFSIGAIVVAIFALLIIGILPVVLNLVG
LQENIDLLITFISWPLLAFTFNFALVLLYRYAPHRKPAKWRWITLGSVIATILWIVASIG
FSFYVSKFASYNETYGSLGGVVIMLMWLYISAYIIILGATINAASEQQTAIDSTIGPDKK
RGERGAYVADHLDVKEPNR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtaaaacgtggtcaagatgcacaacaaccagtaaacattccgttgcttggt
tggtgggatattactaagcgtatttttactcaactgagtcgtgataatttatcgttagtg
gccgctggcgttgcattttatgcgctactggctatttttccggcgcttgctgcacttgta
tctgtttatgcctattttgcatcacctacagatataggagcacatttaagtcaggttatt
gcgctgctaccagagagtaccggagagttaattttgtcgcaaatagccagtattgcccaa
aaatcaggtactagcttgagtttgagcgcaattagcacattaatactaactatttggagt
agttcaaagggcagccaagcattaattacagcctgtaatataagttatcaggaatatgaa
aagcgctctttttttaaagcacaacttgtacgctttttgttttcgattggcgctattgta
gtggctatttttgcgctgttaattattggtattttaccggtagtacttaatttagtggga
ttacaagaaaatatagatttactcatcacgtttatttcatggcctttattagcatttact
tttaactttgccttagtgcttttatatcgctacgcgccgcatcgtaaacctgctaagtgg
cgttggatcaccttaggatctgttattgctacaatattatggatagtcgcttcaattggt
ttttcattttatgtatcgaaatttgccagttataacgaaacttatggctcgttaggtggg
gtggttattatgctgatgtggctttacattagtgcttatattataattttaggagcgaca
atcaatgctgcatcagagcaacaaactgcaatagatagtacaataggcccagataaaaaa
agaggtgagcgcggagcctatgttgccgatcatcttgatgtgaaagagcctaataggtaa

DBGET integrated database retrieval system