KEGG   Pseudoalteromonas translucida: PTRA_b0407Help
Entry
PTRA_b0407        CDS       T04220                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ptn  Pseudoalteromonas translucida
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PTRA_b0407 (ahpF)
Enzymes [BR:ptn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PTRA_b0407 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored NAD_binding_9 FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Lycopene_cycl Amino_oxidase Thioredoxin_9 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ALS34892
UniProt: A0A0U2VB84
LinkDB All DBs
Position
II:399219..400790
Genome map
AA seq 523 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSTEVASLANDLATLSDKFTVINNPDTSA
RRPSMVVHSPIKNTHITFAGVPMGHEFTSLVLALLHTGGHASKAKAEDIEQIKSLTQELN
FEVYISLSCQTCPQVVQALNTMAATNNKIKTTMIDGALFQGEVEERNILAVPAVYLNGEP
FSQGALSLTDILNKVDSKGAQRQAESLSKKEKFDVLVIGGGPAGASAAIYSARKGLNTGI
VADRFGGQVADTLAIENFISIKATEGPKLVAQLEEHVKEYDVDVMHNQRAAKLSRSNNGY
EITLENGAVLSAKSLVLATGARWREMNVTGEQQYRGHGVAYCPHCDGPLFKGKPVAVIGG
GNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKASSMANITIIKSAQTTEVLGDGKK
VTGLTYTDRVSGDSKQLTLAGIFVQIGLIPNTEWLKDSELELSKFGEILIDAKGATSLPG
VYGAGDATNTPFKQIIIAMGSGATASLGAFDYLIRHSDETEQA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaacataaaaaatcaattaaaaagccattttgaatcgcttactcagcct
gttgagctgcttatcgccttggacgacagcaaaaaatcaacagaagtagcaagcttagca
aacgatttagccacactaagcgataaatttacggtaataaacaacccagatacaagcgca
cgacggccgtcaatggttgtacattcacctataaaaaacacccatattacgtttgcgggt
gtacctatgggccatgaattcactagtttagtgttagcgctattgcacacaggcggacat
gccagtaaagcaaaagccgaggacattgaacaaataaaatcacttactcaagagcttaac
tttgaagtgtatataagcttaagttgccagacatgcccgcaagtagtgcaggcacttaat
actatggcagcaacgaataataaaattaaaaccaccatgatagatggcgcgttatttcaa
ggcgaagtagaagagcgaaatattttagctgtaccggctgtttatttaaatggcgaacca
tttagccaaggtgcactaagcctaaccgacatactcaataaagtagatagcaaaggtgca
cagcgccaagctgagtcgttaagtaaaaaagaaaagtttgacgtgttagttattggtggt
gggcctgcgggtgcatcggctgctatttactcagcacgaaaagggttaaacaccggtatt
gttgcagataggtttggcggacaagtagccgatactttagcaatagagaactttatttcg
attaaagccaccgaagggccaaaactagtagcgcaactagaagagcacgtaaaagaatac
gacgtagatgtaatgcataaccaacgtgcagctaagcttagtcgcagtaataatggttac
gaaattaccctagaaaacggcgcggtactgagtgctaagtcgctggtattggcaaccggt
gcacgctggcgcgaaatgaacgtaactggcgagcaacaatatcgtggccatggtgtggct
tattgcccacattgtgatgggcctttatttaaaggcaaacccgttgcggtaattggtggc
ggtaattcaggtatagaagccgcgattgatttggccaatattgtagagcatgtaactgtg
cttgaatttgccgatacattacgtgccgacgaagtacttattcgcaaagctagcagtatg
gctaatattactattattaaaagtgcgcaaacaactgaagtactcggcgatggtaaaaaa
gtaaccggtttaacttacaccgatcgcgtaagtggcgacagtaagcaactcacccttgcg
ggtatatttgtacaaattggtttaataccaaatacagagtggctaaaagacagcgagctt
gaattgagtaaatttggtgagattttaattgatgccaaaggcgcaacatcactcccaggc
gtttatggcgcgggggatgcaaccaatacgccatttaagcaaataataattgcgatgggc
agtggcgcaacagccagcttaggtgcgtttgattacttaattcgccacagcgatgaaaca
gagcaagcttaa

DBGET integrated database retrieval system