KEGG   Picrophilus torridus: PTO0332
Entry
PTO0332           CDS       T00177                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase [NADP+]
  KO
K18128  D-glyceraldehyde dehydrogenase (NADP+) [EC:1.2.1.89]
Organism
pto  Picrophilus torridus
Pathway
pto00030  Pentose phosphate pathway
pto01100  Metabolic pathways
pto01120  Microbial metabolism in diverse environments
pto01200  Carbon metabolism
Module
pto_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:pto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PTO0332
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.89  D-glyceraldehyde dehydrogenase (NADP+)
     PTO0332
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-ProteinID: AAT42917
UniProt: Q6L285
LinkDB
Position
367755..369236
AA seq 493 aa
MKIYIDGEWRDSSSGETIKKYNPSTGEVLDTFPAATRNDVDAAIDSAEDAFKRWSDMTSM
ERSKILYKALELISKDKDQLTDLLIKENGKVKREAMDETEGVIDQLQYYTEFERKLTGDI
VEGTSNKRKIFQYKVPYGIVIAITPWNFPAAMVIRKLAPALLTGNTVILKPSSDTPLTAE
WLVKKFVDAGIPKGVLNLITGKGSEIGDYIVEHKKVSLITMTGSTSTGQRIMEKASKNMA
KLILELGGKAPFMVWKDANIERALKSLVWAKYLNVGQSCIAAERLYIHEDIYDEFMKKFI
EVSKRIKLGDPESSDMGPLINKSAVETTEKYVDIARSSGYKILLGGKKPELSGKYKNGYF
YEPTIIENVPQDSPLFQEEIFGPVIGAESVSSVDELYEKANDSKYGLASYLFTEDPELIF
EASEKIRFGELYVNMPGPEASQGYHTGFRLTGQAGEGSKYGISEYLKLKNVYVDYSRGNL
SISTVNDDLFKNL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaaaatttacatagatggtgagtggagggattcatccagcggcgagaccataaaaaag
tacaatccaagcacaggcgaggttcttgatacgtttccggcggcaacaaggaatgatgtt
gatgctgcaattgactctgcagaggatgcattcaaaagatggagcgacatgacgtcaatg
gaaaggtcaaaaatactttacaaagcccttgaattaatatcaaaggataaagatcagcta
acggatcttttaattaaagagaacggaaaggtgaaaagggaggccatggatgaaaccgag
ggcgttatagaccagttacagtattacacggaattcgagagaaagctaaccggtgacatc
gttgaaggcacaagcaataaaagaaagatatttcaatacaaggttccatatggaatagta
atagcaataacgccatggaacttccctgcagcaatggtgataagaaagcttgcgcctgca
cttttaactggaaacaccgtaatattaaagccaagctcagacacaccattaactgcggaa
tggctcgtgaaaaaatttgttgatgccggaataccaaagggcgttttaaatctaataaca
ggcaagggctctgaaataggtgattacatcgttgagcataaaaaggtatcattgataaca
atgaccggatcgacatccacgggccagaggatcatggaaaaggcatcaaagaacatggca
aaattgatacttgagctcggcggaaaggcaccgttcatggtctggaaggacgcaaacatt
gaaagggcattaaagtccctggtctgggcaaagtatttaaacgttggccagtcatgcata
gccgctgaaagattatacatacacgaggatatatacgatgaatttatgaaaaagttcatt
gaggtaagcaaaagaataaaacttggagacccggagagctctgacatgggcccattgata
aataaaagcgcggttgaaacaacggaaaaatacgttgatattgcaaggagctcgggatat
aaaatactccttggcggcaaaaaaccggagctatcaggaaaatacaaaaatggatacttc
tatgaaccgacgataatagaaaacgttccacaggattcgccattattccaggaggagatc
tttggcccggtcataggcgcagagagtgtatccagtgtcgatgaattatacgaaaaggca
aatgattcaaagtacggacttgcctcttatttattcacagaggatcctgagttaatattt
gaggcatccgagaagataaggttcggtgagttgtacgtcaacatgccagggcctgaggca
tcacaggggtatcatacaggattcagattgacaggacaggccggcgagggaagcaagtac
ggaatctcagaatacctaaagttaaagaacgtctacgttgattactcaagggggaatcta
agcataagcactgtaaacgacgacctattcaaaaatctttaa

DBGET integrated database retrieval system