KEGG   Picrophilus torridus: PTO0672Help
Entry
PTO0672           CDS       T00177                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pto  Picrophilus torridus
Pathway
pto03030  DNA replication
pto03410  Base excision repair
pto03420  Nucleotide excision repair
pto03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PTO0672
   03410 Base excision repair
    PTO0672
   03420 Nucleotide excision repair
    PTO0672
   03430 Mismatch repair
    PTO0672
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pto03032]
    PTO0672
   03400 DNA repair and recombination proteins [BR:pto03400]
    PTO0672
Enzymes [BR:pto01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PTO0672
    6.5.1.6  DNA ligase (ATP or NAD+)
     PTO0672
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PTO0672
DNA replication proteins [BR:pto03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PTO0672
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PTO0672
DNA repair and recombination proteins [BR:pto03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PTO0672
   NER (nucleotide excision repair)
    Other NER factors
     PTO0672
   MMR (mismatch exicision repair)
    Other MMR factors
     PTO0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AAT43257
UniProt: Q6L195
LinkDB All DBs
Position
690837..692609
Genome map
AA seq 590 aa AA seqDB search
MLYINMDFSDVASYFSRMEETTKRLELTSILAELFKRSGDDLKKLVYLVQGKLMPDYLGI
ELGLSDKLIIKSLSKASGRSEEDINRIFSRLGDLGSTAEEISSSGIQRPLLKESLTVDYV
YNQLIKISGYTGHGSIKTKMDAYIDLLINSGPMEIKYITRIITGKLRLGVADSTILDGLI
EAFSEKKYADDIETAYNFHPDLGYIAENLMMGNINELLNAGPVPLIPFKVMLAERLQSIS
DIRNKMGHNASYEYKYDGLRTQLHFLKGGIKIFSRGLEETTSSFPDIVQNFKSYYSFDSC
IIDGESVPYNPETGELYPFQMVSKRRGRKYELTEKTREVPIVMFIFDILYLNGKSLVNLP
YPERRSILEKNFKENEYFKLAKRIVSDDEHDIMKFFERSIEEGCEGIVAKSNGIDSIYRA
GARGWLWIKFKRDYQSELSDSLDLVVVGAFDGHGRRKGTFGALLLACYNSKDDTFETVCK
LGSGFTDEMLSEMPRLLGDKIVEKKPARVNSSMEPDHWIYPSLVLEIRGAEITVSPVHTC
AMNIIEKGSGLALRFPRLIKPRDDKKPEDATTTNEIIEMYKAQKKVIEKS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgttatatataaatatggatttctcggatgttgcatcatacttctcaaggatggaggaa
acaacaaaacgtttggaattaacatcaatacttgctgagctttttaaaagatcaggtgat
gatttaaaaaagcttgtctaccttgtacagggcaagctaatgccggattacttgggcata
gagcttgggctttcagacaaattgataataaaatcgctttcaaaggcgtcgggcagatca
gaagaggatataaacaggatcttctcgaggcttggcgatcttggctccacagcagaggaa
ataagctcatctggaattcaaaggccacttctaaaggaaagtttaacagtcgattatgtt
tacaaccagcttattaagatctcaggttatacaggtcacggaagcataaagacaaagatg
gatgcatacatagatcttttaataaactcgggacccatggagataaaatacataacaagg
ataataactggaaaattaaggcttggcgttgcagattcaacaatacttgatggcttaata
gaggcattttcagagaaaaaatacgcagatgatatagaaacagcgtataattttcacccg
gatcttggctacattgcagagaacctaatgatgggaaatataaatgaacttttaaatgcc
ggtccggttccattaataccatttaaggtcatgctggcagagaggcttcaatcaatttct
gatataagaaataagatggggcacaatgcatcatatgaatataaatacgatggcctcagg
acacagctgcacttccttaaaggcgggataaagatattttccaggggtcttgaggaaacg
acatcaagctttcctgacattgttcaaaattttaagtcatactattcatttgattcgtgt
ataatagatggtgaatcagtgccatacaatcctgaaacaggtgaattatatccatttcaa
atggtttcaaagcgtcgtgggagaaaatatgaactaacagaaaaaacaagggaggtgcca
attgtcatgtttatattcgatatattatatttaaacggtaaatcccttgttaatctgcca
tatcctgaaaggagatcaatactggagaagaattttaaggaaaacgagtactttaagctt
gcaaaaagaatagtttcagatgatgaacacgatataatgaaattctttgaaagatcaata
gaggagggctgtgagggtatagttgcaaagagtaacggcatagattcaatatacagggca
ggtgccaggggctggttatggataaagtttaagagggactaccagagtgagctttccgac
tccctggatctggttgttgttggtgcattcgacggccatggacgtagaaagggaacattt
ggggctcttttgctggcatgctataacagcaaagatgacacatttgaaacggtatgcaag
cttggctcgggctttacagacgaaatgctatctgaaatgccaaggctccttggggacaaa
atcgttgaaaagaagcctgcaagggtgaactcatcaatggaaccggatcactggatatat
ccgtcacttgttcttgagatacgcggtgctgaaataacagttagccctgttcatacctgt
gcaatgaacatcatagaaaagggctctggccttgcattaaggtttccaaggttaataaag
ccaagggatgataaaaagccagaggatgcaacaacaacaaatgagattatagaaatgtat
aaagcacagaaaaaggttattgagaagagttaa

DBGET integrated database retrieval system