KEGG   Picrophilus torridus: PTO1310Help
Entry
PTO1310           CDS       T00177                                 

Definition
(GenBank) glucose/galactose transporter
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 WIYLD
Motif
Other DBs
NCBI-ProteinID: AAT43895
UniProt: Q6KZF7
LinkDB All DBs
Position
1315583..1316575
Genome map
AA seq 330 aa AA seqDB search
MITIGILGAYLIGMLVFFIAPGLAYAVDWRILLGVAAVPSLIGLAFRLYMPESPRWLILH
EKFDKAVDALKKFGIDATMEQIKRTYSYLRATETRIKETAGIKRAFVIVALFMMFQQITG
INVPFYYGPVIISKLHLFPSVSGIYSTVYAIGASAILAIINVLATYIGFRLIDTHGRRSL
ALMGYAGMAFFDFIGTILYLMHFSIGLLIGFAGFIIFFAFGVGGTGWIIQGEYFPTRYRG
LFASLIAFVDWISNFAIIEIFPYMDKTIGIGYTMLIFGILSVMAFITFFMIMPVTRGKSV
EDITEMFEDNPLLGVKEASKVTDVNKSETR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgataacaataggcatccttggtgcatatctaataggcatgcttgtattcttcattgcg
ccgggccttgcctacgccgttgactggagaatcctgctaggggttgcggccgttccgtct
ttaataggccttgcctttagactttacatgcctgagtcacccaggtggctcatattgcat
gaaaaatttgacaaggcagttgacgcattgaaaaaatttggaatagatgcaacgatggag
cagataaaaaggacatacagctatctcagagcaacagaaacaagaataaaggaaacggca
ggaataaaaagggcctttgtcattgttgcgctgttcatgatgttccagcagattacaggt
ataaacgtaccgttttattacgggcctgttattatatcaaagctgcacctgtttccaagc
gtatctggaatatactcaacggtatatgccataggtgcatctgctatacttgcaattata
aacgttctggcaacttacattggctttagattaatagatacacatggaaggagatcactg
gcattgatgggctatgcaggtatggccttctttgacttcatcggcacgatattatattta
atgcacttttccataggcctattaattggctttgcgggctttataatattctttgccttt
ggcgttggtggaacgggctggataatccagggtgagtacttcccaacaaggtaccgtggc
ctctttgcatcattaatagcctttgttgactggatatcaaactttgcaataatagagatc
tttccatacatggataaaacaataggcataggatacacaatgctcatctttggtattctt
tcagttatggcatttataacgttctttatgataatgcctgtaacaaggggaaaatcagta
gaggatataacagagatgttcgaggataacccattgctgggcgttaaggaggcatcaaag
gttacagatgtaaataaatctgaaacaagataa

DBGET integrated database retrieval system