KEGG   Planktomarina temperata: RCA23_c01690Help
Entry
RCA23_c01690      CDS       T03229                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ptp  Planktomarina temperata
Pathway
ptp00240  Pyrimidine metabolism
ptp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RCA23_c01690 (tdk)
Enzymes [BR:ptp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RCA23_c01690 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14 DUF2075
Motif
Other DBs
NCBI-ProteinID: AII85736
UniProt: A0A076JV45
LinkDB All DBs
Position
complement(186917..187519)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTLLLQASHNYKERGMQTYLLTAQMDTRAGQGKIASRIGIGEEAD
TFTTQDDLFEKIQNRLAQGPVACAFIDEAQFLTKEQVWALARVVDDLGLPVMCYGLRVDF
LGELFPGSAALLALADEMREVRTICHCGKKATMVVRFDSTGKAVTAGDQVQIGGNETYLS
LCRKHYRAAVADDRSPELPI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctaagctctatttcaactactccacgatgaacgccggcaaatcgactttgctgctg
caggcgtcgcataactacaaggagcgcggtatgcagacctatctgctcaccgcgcaaatg
gacacaagggccggtcagggtaaaatcgcctcccgcatcggcattggcgaagaggcggac
acgtttaccacccaggatgacctctttgagaagatacaaaatcgactggcacagggtccc
gtcgcctgcgcctttattgatgaagcgcagtttttgaccaaggaacaagtttgggccctg
gcccgcgtggtcgatgaccttggcctgcccgtcatgtgctatggcctgagagtggatttt
ttgggggagctgtttccggggtccgccgcgcttttggcgctggctgatgaaatgcgcgag
gtacggaccatctgccattgcggcaagaaggcgacaatggtcgtgcgatttgacagcact
ggcaaagccgtcacggccggcgatcaagtgcagataggcggcaatgaaacctacctttcg
ctttgccgcaaacattaccgcgccgcagtggcggacgataggtccccagagctgccaatc
taa

DBGET integrated database retrieval system