KEGG   Planktomarina temperata: RCA23_c10480Help
Entry
RCA23_c10480      CDS       T03229                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ptp  Planktomarina temperata
Pathway
ptp00473  D-Alanine metabolism
ptp00550  Peptidoglycan biosynthesis
ptp01100  Metabolic pathways
ptp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ptp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RCA23_c10480 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RCA23_c10480 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RCA23_c10480 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ptp01011]
    RCA23_c10480 (ddl)
Enzymes [BR:ptp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RCA23_c10480 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ptp01011]
 Precursor biosynthesis
  Amino acid ligase
   RCA23_c10480 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AII86599
UniProt: A0A076K3W2
LinkDB All DBs
Position
1118953..1119843
Genome map
AA seq 296 aa AA seqDB search
MAVLMGGLGAERAVSLSTGQECATALRQVGYRVVEIDAGADLVADLQRVQPDVVFNALHG
RWGEDGCVQGVLEWMQIPYTHSGVLSSALAMDKEKTKEVFRAEGLPVVESLLIARADLGK
THPMALPYVIKPNNEGSSVGVYLVEESALSPPPLSDDMPDVVMVEAFAPGRELTTTVLGA
RALTVTDILTDRWYDYDAKYVEGGSQHIVPANLPQDIFSACLDYALKAHEVLGCRGISRT
DFRWDEGRGLDGLVLLETNTQPGMTPTSLSPEQAEAMGISFPDLCKFLVEDASCNR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtggccgttttgatgggtgggctaggcgcggagcgcgcggtctccctgtcgacaggtcaa
gaatgcgccaccgccttgcggcaggtgggctatcgggttgttgagattgatgcgggcgcc
gatctcgttgccgatttgcagcgggtgcagcccgatgtggtcttcaacgcgctgcatggt
cgatggggcgaggatggctgtgtgcagggtgtgctggaatggatgcaaattccatacacg
cattcaggtgtgctcagctcagcgctggcaatggataaagagaaaaccaaagaggtcttc
cgcgccgaaggcctgccggtcgtcgagagcttgttgattgcgcgcgcagatctgggcaag
acgcatccgatggcactgccttatgtgattaaacctaacaatgaaggatcctccgttggg
gtctatttggtcgaagagagcgcgctttccccgccgcccctgtcggatgatatgcccgat
gtggtcatggtggaagccttcgcgccgggccgtgagctgaccacaaccgtattgggcgcg
cgggctctgacggtcacggatattttgaccgatcgctggtatgactatgatgcgaaatat
gtcgaaggcgggtctcagcacatcgtgccggccaatttacctcaggatattttctcggca
tgtttggactatgcgctgaaagcgcatgaggttttgggttgccgcggaatctcgcgcaca
gattttcgttgggacgagggccgcgggttggatggtttggtcctgctggaaaccaacacc
cagcccggtatgacaccaacgtcgctctcgccagaacaggctgaagcaatgggtatttct
tttcccgatttgtgcaagtttttggtggaggatgcctcatgcaaccgttaa

DBGET integrated database retrieval system