KEGG   Planktomarina temperata: RCA23_c16060Help
Entry
RCA23_c16060      CDS       T03229                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ptp  Planktomarina temperata
Pathway
ptp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ptp01100  Metabolic pathways
ptp01110  Biosynthesis of secondary metabolites
ptp01130  Biosynthesis of antibiotics
ptp01230  Biosynthesis of amino acids
ptp02024  Quorum sensing
Module
ptp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ptp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCA23_c16060
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RCA23_c16060
Enzymes [BR:ptp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     RCA23_c16060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AII87143
UniProt: A0A076K4M0
LinkDB All DBs
Position
complement(1727291..1728661)
Genome map
AA seq 456 aa AA seqDB search
MTSWQKSDWRNKPRVQMPDYTDQAALAAAEQQLRQYPPLVFAGEARALRQQLAAVSRGEA
FLLQGGDCAESFKEFSADNIRDTFKVMLQMAMVLTYGAKVPVVKVGRMAGQFAKPRSAPT
ETQNGVELPSYRGDIINELDFTPEARIPNPQKMLQAYTQAAATLNLLRAFSKGGFADIHQ
VHSWTLGFTESQKASAYREMANRISDALDFMEAAGLTSEKNAELSSVDFYTSHEALLLEY
EEALCRLDSTSGTYVAGSGHMVWIGDRTRQPDGAHVEFCRGVQNPIGLKCGPTTTAEDLK
VLMEKLNPNNEAGRLTLIARFGAGAVGDHLPRLIKTVNEEGANVVWTCDAMHGNTIKASS
GYKTRPFESVLREVQEFFAIHRSENTVPGGVHFEMTGQDVTECTGGVRAVTDENLSDRYH
TACDPRLNASQSLELAFLVAEELSQTNKTRAARLAV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctggcaaaaatctgattggcgcaataagccgagagttcagatgcccgactat
acggaccaagcggccttggccgcggctgaacagcagttgcggcaatatccaccgctcgtt
tttgctggcgaagcgcgggccttgcgtcagcaattggccgccgtcagtcgcggcgaggcc
tttctattgcagggcggcgattgtgctgaaagctttaaagagttttccgccgacaacatc
cgcgacacgttcaaagtgatgctgcaaatggccatggttttgacttatggcgcaaaagtg
cctgtggtcaaagtgggccgcatggctgggcagtttgccaaaccccgctctgctccgacg
gaaacccagaatggtgtcgaactgccgagctatcgcggtgacattatcaatgagctcgat
ttcacccccgaggcccgcattccaaacccgcagaagatgttgcaagcctatacccaagcg
gcggccactctgaacctcttgcgcgcgttttccaaaggcgggtttgcggatattcatcag
gtgcattcttggactttgggattcaccgaatcgcaaaaggcttcggcctatcgtgaaatg
gcaaaccgaatttcggatgccttagatttcatggaggcggctgggctgacctctgagaaa
aatgctgagctaagttccgttgatttttatacctcccatgaggcgctgctgctggagtat
gaagaggccttgtgccgattggacagcacaagcgggacctatgtggcgggatcgggacat
atggtgtggattggcgatcggacccgccaacccgatggcgcccatgtcgagttctgtcgc
ggtgtgcaaaacccaattggcctgaaatgtggcccgacaacgacagcggaagaccttaag
gtattgatggaaaaactgaaccctaacaatgaagcggggcgtttgacgctcatcgcacgc
tttggcgctggcgctgtcggcgatcacctgccgcgtttgatcaaaacggtcaacgaggaa
ggtgcgaatgtggtttggacctgtgatgcgatgcatggcaacaccatcaaggcgtcctct
gggtataaaacccggccgtttgaaagcgtattgcgcgaggtgcaagaattcttcgccatc
cacaggtcggaaaataccgtgccgggtggcgtgcattttgagatgaccggccaagacgtc
accgaatgcaccggcggcgtgcgggctgtgaccgatgagaatctgtcagatcgctatcac
acggcctgtgatccgcgtttgaacgcatcacaatctttggaactggcctttttggtcgct
gaagagttgagtcaaaccaacaaaacccgcgcggcgcggttggccgtttag

DBGET integrated database retrieval system