KEGG   Planktomarina temperata: RCA23_c17930Help
Entry
RCA23_c17930      CDS       T03229                                 

Gene name
futA
Definition
(GenBank) ABC transporter periplasmic iron-binding protein FutA
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
ptp  Planktomarina temperata
Pathway
ptp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ptp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RCA23_c17930 (futA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptp02000]
    RCA23_c17930 (futA)
Transporters [BR:ptp02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    RCA23_c17930 (futA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AII87327
UniProt: A0A076K4X4
LinkDB All DBs
Position
1923546..1924556
Genome map
AA seq 336 aa AA seqDB search
MPYFRPIALALCAFALAVPVAAQEVNVYSYREPALIQPLMDGFTEQTGIAVNVAFLNKGM
IERLRAEGRRSPADLVFTTDISRLHSVVSAGLTQPVTEAKLTDNIPAAYRDPGNHWFGLT
VRARVIYASKARVKKGGVTSYEDLADPKWQGRICTRSGTHSYMLALTAAYLHHHGEANTL
NWLKAVKANLARKPQGNDRAQVKAIWAGECDISLGNTYYMGQMLADPEQQDWASSVSIEF
PVFEGAGTHVNVSGMAMTKFAPNRAEALALMAYLAAPAAQEVYASDNYEYPIAPGTQADP
LVQSWGSFEADPVNLSTIAELRSEALLLTELADFDG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccctattttcgccccatcgctctcgccctatgcgcctttgcccttgccgtccccgtg
gccgcccaggaggtcaacgtctattcctatcgcgagccggccttgatccagcctttgatg
gatgggttcaccgaacagaccggaattgcggtcaatgtcgcctttctcaacaagggcatg
attgagcgtttgcgggccgagggcaggcgctcgcctgcggatttggtattcaccacagat
atttcacggcttcacagcgtggtctcagccgggctgacccaaccggtgacagaagccaag
ctcacggacaacatccccgcggcctatcgcgatcccggcaatcattggtttggcctaacc
gtccgcgcccgcgttatctatgcctcaaaagcacgggtcaaaaaggggggagtgaccagc
tacgaagatctcgcagatcccaaatggcaggggcgtatctgcacccgctccggcacgcat
tcttatatgcttgccctcaccgccgcctatttgcatcaccatggtgaagcaaacacattg
aattggctcaaagcggtgaaagccaatctggcgcgcaaaccgcaaggcaacgaccgggcg
caggtcaaagcgatttgggcgggtgaatgtgatatttcccttggaaacacttactatatg
ggccaaatgctggctgatcccgagcagcaagactgggccagcagcgtctcaattgaattt
cccgtgtttgagggggcgggcacgcatgtgaatgtgtcgggcatggcgatgaccaaattt
gcgcccaatcgggctgaggccctggcccttatggcctatcttgccgcgccagctgcccaa
gaggtttacgcatctgacaattacgaatacccgattgcccctggcacccaggccgatcct
ttggtgcaaagctggggcagctttgaggccgacccggtcaatctcagcacgattgccgag
ctccgctcagaggcgctgctgctcaccgaattggctgattttgatggctga

DBGET integrated database retrieval system