KEGG   Psychroflexus torquis: P700755_001820Help
Entry
P700755_001820    CDS       T02275                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase GlpA
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00564  Glycerophospholipid metabolism
ptq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    P700755_001820
Enzymes [BR:ptq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     P700755_001820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Thi4 Pyr_redox_2 HI0933_like Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AFU68654
UniProt: K4IE27
LinkDB All DBs
Position
1935926..1937503
Genome map
AA seq 525 aa AA seqDB search
MIKQLLFDRKHLIENAKKVKEWDVIVIGGGSTGLGIALDSVTRGYKTLLLEQLDYAKGTS
SRSTKLVHGGVRYLAQANFSLVTEALKERGLLEQNAPHLVKNQTFLIPNYTWWEGPYYTL
GLKAYDFLAGKLSLGASKHLNKSETIRKLKTIKKDKLRGSVSYQDGQFDDSRLAVNIAQT
AIEKGGSLLNYFKVKNLTKDTDNKVSGVLAIDQETKEEHLFKGKAIINATGVFADDILQM
DEPGSKNIIQPSQGVHLVFDKEFLPGEDALMIPKTDDGRVLFAVPWHDKVIVGTTDEMVD
SHTTEPNASEKEVEFILETFNRFIERKATRADVKSIYAGLRPLAAPEDDSGKTKEISRGH
KIFVSDTGLVSITGGKWTTYRKMAEDTLDKVIALNKLPKKECVTERLLIHGAMETEERGN
HLYVYGTDQVHLKTLLIENPSLGEKIHPDLEFQNVEVLWAARHEMARTVEDVLARRVRVL
FLDAKRSIEMAPNVAEILAKELNKDKSWISTQIEDYTQLAKGYLM
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacagctactttttgacagaaaacatctcattgaaaacgcaaaaaaagtaaag
gagtgggatgtcattgtaatcgggggaggatccactggtcttggaattgcattagatagc
gtcactagaggttataaaactcttcttctggaacagttagattatgccaaaggaacgtca
agcagaagtactaagcttgtccatggtggtgtccgatatcttgcacaagccaatttttcc
ctagttacagaagccttgaaagaaagaggcttactagagcaaaatgctccacatctagtt
aaaaatcaaacctttttaattccaaactacacttggtgggaaggtccttattatacgcta
ggtttaaaagcctacgactttcttgctgggaaattaagtttaggtgcttctaaacatctg
aataaaagtgaaaccattcgtaagttaaaaacgattaaaaaagataaattgagagggagt
gttagttatcaagatggtcaatttgacgattctagactagcagtaaatattgcacaaact
gccattgaaaaaggaggctctttactcaattatttcaaggtcaaaaatttaacaaaagac
actgataataaagtatctggtgttctagccatcgatcaagaaaccaaagaggaacatctc
tttaaaggaaaagctattatcaatgccacaggagtttttgcagatgatattttgcaaatg
gacgagcctggctccaaaaatataatacaacctagccaaggagttcatttggtttttgat
aaagagtttcttcctggagaagatgctctaatgataccaaaaactgatgatgggagagtt
ctctttgcagtcccttggcatgataaagtgattgtggggactaccgacgaaatggtagat
tctcataccacagagcctaatgcctcagagaaagaggttgagtttatcctagaaaccttc
aaccgttttatagaaaggaaagccacacgagcagatgtgaaaagtatatacgccggtctt
agaccacttgctgcaccagaagatgatagcggaaagacaaaagagatttccagaggacat
aaaatcttcgtttcagatactggtcttgtttctattacgggtggtaagtggactacctac
agaaaaatggcagaagataccctcgataaagtaatcgctttaaataaacttcctaaaaaa
gaatgtgtcacagaacgtcttttgatacatggcgcgatggaaacagaggaaagagggaat
cacctttacgtttatggtactgatcaggtccatcttaaaactttactaatagaaaaccct
agcctaggagaaaagatacacccagacctggagtttcaaaatgtagaagttttgtgggcg
gcaaggcatgaaatggcaagaactgttgaggatgtcttagcaagaagagtgagagtctta
tttctagacgctaagcgttctattgaaatggctcctaatgttgcagaaattttagcaaaa
gagctcaataaagataagtcgtggatatccacgcaaattgaagactatactcaactcgct
aaaggatacctcatgtaa

DBGET integrated database retrieval system