KEGG   Psychroflexus torquis: P700755_002441Help
Entry
P700755_002441    CDS       T02275                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, E1 component SucA
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00020  Citrate cycle (TCA cycle)
ptq00310  Lysine degradation
ptq00380  Tryptophan metabolism
ptq01100  Metabolic pathways
ptq01110  Biosynthesis of secondary metabolites
ptq01120  Microbial metabolism in diverse environments
ptq01130  Biosynthesis of antibiotics
ptq01200  Carbon metabolism
Module
ptq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ptq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P700755_002441
  09105 Amino acid metabolism
   00310 Lysine degradation
    P700755_002441
   00380 Tryptophan metabolism
    P700755_002441
Enzymes [BR:ptq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     P700755_002441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N Peptidase_C58 PFOR_II
Motif
Other DBs
NCBI-ProteinID: AFU69207
UniProt: K4IF85
LinkDB All DBs
Position
2629549..2632362
Genome map
AA seq 937 aa AA seqDB search
MDKYSFLNAMSPSLLADLYNQYLQNPDGTEPSMRAFFQGFDFGLESGESLGEPSNGTTTV
TLNNSETKETEKIQVSENVQKEFQVINLIDGYRHRGHLFTKTNPVRERRKYSPKLDIENF
GLSQRDLDVKFEAGEIIGIGKTSLRKIIEFLENVFCDSIGVEYAYIRNPKEIKWIQDKIY
HNQNKTDFSNTQKKNILRKLNEAVTFETFLHKSYVGQKRFSLEGNESLIPALDTLIEGAA
DIGVKEFVMGMSHRGRLNTLVNIFGKSPKTIFNEFEGKDFEIDGFDGDVKYHLGWTCKRQ
SDSGKEINLNMAPNPSHLETVGSIVQGIARAKQDDHYLGEEQYVLPIVVHGDAAIAAQGI
AYEIVQMAQLDGYKTGGTIHIVVNNQIGFTTNYIDGRSSTYCTDVAKVTLSPVLHVNADD
AEAVVHAMNFALQFRMEFGRDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAISEHKNPRDI
YVDKLVEQGIISTDYLDQLEESVKSKLSEEYEDSKKDDNVVVTKILQEEWEGYEAADKDE
MLKPVDTTFDLKELSKLAEAITTLPKDKIFMKKINKLMKTRHSMYFEKNELDWAMGELLA
YATLLKEGHDVRISGQDVERGTFSHRHGVIITENSEEEYIPHNNLGGEQSKFYIYNSLLS
EYAVVGFDYGYAMASPSSLTIWEAQFGDFSNGAQVIIDQYISSAEDKWKTQNGLVMLLPH
GYEGQGSEHSSARMERYLQLCAKDNMFVANCTNPANYFHLLRRQQKTNYRKPLIVFTPKS
LLRHAQVISSKEELAEGSFQTVIDDAKAKVKETKTLVFCSGKFYFDLKKRREEEKRNDVA
LVRVEQLFPLPKEEMNKIIKKYKNAKDVVWAQEEPRNMGAYTHLLLQYDKTKDFRVCSRR
FYGSPAAGSQTRFKRRHDEVIDYVFDASKDNCLNDYK
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatattcctttttaaatgcgatgtctccatcgctattagcagatctttataat
caatatttacaaaatcctgacggtacagagccaagcatgagagccttttttcagggtttc
gactttggtctagagtccggagaatctcttggagaaccctctaacggaacgacaactgtc
accctaaacaattctgaaaccaaagaaactgaaaagattcaggtgtcagaaaatgtgcag
aaagaattccaagttattaaccttatagacggttatcgccaccgaggacatttatttact
aaaacaaatcctgtaagggagcgtcgtaaatattcgccaaaactagacatcgaaaacttt
ggtttatcccagcgagatctggatgtaaaatttgaagctggagaaattataggtattggt
aaaacctccttgagaaaaatcatcgagtttttggagaatgtattttgtgattctatcggt
gtagaatacgcttacattcgaaatccaaaagaaataaaatggattcaggataaaatttat
cacaatcaaaataagactgatttttctaatactcagaagaaaaatattttaagaaaactg
aatgaagctgttacttttgaaacattcctacataaaagttatgttggacaaaagcgattt
tcgctagagggtaacgaatctttgattcctgctttagataccttaatagaaggtgcagca
gatataggagtaaaagagtttgtgatgggaatgtcccaccgtggtcgtttaaataccttg
gtgaatatttttggtaaaagcccaaagacgattttcaatgagtttgaaggcaaagacttt
gaaattgatggatttgatggtgacgtgaagtaccacttaggatggacttgtaaacgccaa
agcgactcaggtaaagaaattaatctcaacatggctcccaacccgtctcacctagaaact
gttggttctattgtgcaagggatagcgagagcaaagcaagatgaccattatttgggagaa
gaacaatatgttttacctatcgttgtccatggggatgccgctatcgcagcgcaaggtatt
gcctatgaaatagtccaaatggcacagctagatgggtataaaacaggaggaactatccat
attgtagtgaataaccaaattgggtttaccaccaattatatagatggaagatcctctact
tactgtacagatgttgctaaagttaccttatctcctgtactccatgtgaatgcagacgat
gcagaagcggttgtccatgcgatgaactttgctctacaatttagaatggaatttggtaga
gatgtctttatcgatttgttggggtatagaaaatatggacataacgaaggggatgagcca
agatttactcagcccaaattatacaaggcaatttctgagcataaaaatcctagggatatt
tatgtagataaattggtggaacaagggatcataagcacagattacttggaccaattagag
gaaagcgtaaagtctaaacttagcgaagaatacgaagactctaagaaagatgataacgta
gtagttaccaaaattctccaagaagaatgggagggttatgaagctgcagataaagatgag
atgctcaagcctgtggataccaccttcgacttgaaagaactttcaaaactagcagaagcc
atcacgaccttaccaaaggacaaaattttcatgaagaagataaataagctcatgaaaact
cgtcattctatgtattttgaaaaaaatgagctagactgggcaatgggtgagcttctagct
tacgcaactttattgaaagaaggtcatgatgttagaatatctggacaagatgtagagcgt
ggaaccttttcccacagacatggggttatcatcactgaaaatagcgaagaagagtatatt
ccccataataatctaggtggagaacaatctaaattttatatttacaattctcttctttca
gaatatgcagtggtagggttcgattatggttatgccatggcaagtccatcgtcgctaacc
atctgggaggcacaatttggagatttcagtaatggagctcaagtcattatcgatcaatac
atttcctcagcagaggataaatggaaaacgcaaaatggtttagttatgctcttacctcat
ggttatgaggggcagggatcagaacattcttcagcaagaatggaaagataccttcagttg
tgtgcaaaagacaatatgtttgtcgccaactgtaccaatccagcaaattatttccacttg
ttaagacgtcagcaaaagacaaactatagaaagcctctcattgtatttacgcctaaaagt
ctattgaggcatgcacaggtgatatcttcaaaagaagaattggcagagggaagtttccaa
actgttatagatgatgccaaggctaaggtaaaagagaccaagactctagtgttttgttct
ggtaaattttattttgatcttaaaaagagacgagaagaagaaaaaagaaatgatgtggct
ttagtgagagttgaacagctctttccattgcctaaagaagagatgaataaaatcatcaag
aagtataagaatgccaaggatgtggtttgggctcaagaagaaccaaggaatatgggagcc
tacacacatcttctgttgcaatatgataaaacaaaagactttagagtctgtagtagacgt
ttttatggctctcctgcggcaggaagtcaaacaagattcaagagaagacacgacgaagtt
atcgattatgtattcgatgcttcaaaagacaattgtttaaacgactacaaataa

DBGET integrated database retrieval system