KEGG   Psychroflexus torquis: P700755_002514Help
Entry
P700755_002514    CDS       T02275                                 

Definition
(GenBank) pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase AceF
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00010  Glycolysis / Gluconeogenesis
ptq00020  Citrate cycle (TCA cycle)
ptq00620  Pyruvate metabolism
ptq01100  Metabolic pathways
ptq01110  Biosynthesis of secondary metabolites
ptq01120  Microbial metabolism in diverse environments
ptq01130  Biosynthesis of antibiotics
ptq01200  Carbon metabolism
Module
ptq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ptq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P700755_002514
   00020 Citrate cycle (TCA cycle)
    P700755_002514
   00620 Pyruvate metabolism
    P700755_002514
Enzymes [BR:ptq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P700755_002514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFU69273
UniProt: K4IHI1
LinkDB All DBs
Position
2701085..2702803
Genome map
AA seq 572 aa AA seqDB search
MAEVVNMPRLSDTMEEGVVAKWLKQKGDKVEEGEILAEIETDKATMEFESFHDGVLLHIG
VEEGEGAPVDTLLAIIGEEGEDISDLIKNSGKENSSDGKAEKTEAVDSTKSTSKEEAIED
TDEDDAEVPDGVEVVTMPRLSDTMEEGTVSTWLKSVGDDVKEGEILAEIETDKATMEFES
FYTGKLLYIGIGEGESAPVDDVLAVIGPEGTDVDKVLKSLKPEGKSSKSKSDSSSDKESE
SFSEETKEVPKASAPLELDVDENADNTDEQGRILASPLAKKIAEDKGIDLRKVSGSGDHG
RIVKKDVENFKPSVQPAEVKTEKVSIEEPKEQPSLPVAELYTPAGEESFEDVKNSQMRKT
IAKRLLESKNSAPHYYLNIEVDMENAMASRSHINEMPDVKVSFNDLVIKASAMALRKHPQ
VNSSWDGEVTKIANHIHVGVAVAVDEGLLVPVLEFADQQSLTQIGSNVKNLAGKAKNKKL
QPNEMEGSTFTVSNLGMFGITEFTSIINQPNSAILSVGTIVEKPVVKKGEIVVGHTMILT
LACDHRTVDGATGAKFLQTLKIYLENPVTMLA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagtaaatatgccaagacttagtgacaccatggaagaaggtgttgtcgct
aaatggctaaaacaaaaaggagataaggtagaggaaggcgaaattttagctgaaatcgaa
accgataaagcaacgatggagtttgaatctttccacgacggtgtgcttctgcatattgga
gttgaggagggtgaaggagctcctgtagatacccttctagccatcattggtgaagaagga
gaagatataagcgatcttattaaaaactctggcaaagaaaattcctctgatggaaaagct
gagaaaactgaagcagtggattctacaaaatccacttccaaagaagaagcaattgaagac
actgatgaagacgatgccgaagttcccgatggagtagaggtggttactatgccaaggcta
agtgacaccatggaagaaggaacagtctccacttggctaaagtcagtaggagatgatgta
aaagaaggcgaaattttagctgaaatcgaaaccgataaagcgacgatggaattcgaatct
ttctatacaggtaaacttctatatataggtataggtgaaggtgaatctgcaccagttgat
gatgttcttgcggttataggaccagaaggaacagatgttgataaagttttaaaatctctt
aaacccgaaggaaaaagttcaaaatcaaaatctgactctagttcagacaaagaaagtgaa
tcattttctgaagagactaaagaggttcctaaggcgtcagcaccactggagttagacgtt
gatgaaaatgcagataacacagatgaacaaggaagaatactagcctctcctttagctaag
aaaattgctgaagataaagggatagacctcagaaaggttagtggatctggtgatcatgga
agaatcgtgaagaaagatgttgaaaacttcaagccttcagtgcaaccagctgaagttaaa
actgaaaaagtttccatagaagaaccaaaagaacaaccttccttaccagtagctgaactg
tatactcctgctggggaagagtcatttgaagatgtgaaaaactctcaaatgaggaaaacg
atcgctaaacgattgttagaatctaaaaattctgctcctcattattacctcaatattgag
gtggatatggaaaatgccatggcttccagatctcatatcaacgaaatgccagacgttaaa
gtttcctttaatgatcttgtgattaaagcttctgcgatggcattgagaaaacaccctcaa
gtcaattcatcatgggatggtgaggtaactaaaatagcaaatcatattcacgttggtgta
gctgtagcggttgacgaaggtttacttgttcctgtattggaatttgcagatcaacagagt
ttaactcaaattggctccaatgtaaaaaaccttgccggtaaagcaaaaaataaaaaatta
cagcctaacgaaatggagggcagtacatttacagtttccaacttaggtatgtttggaatt
actgaatttacgagcattattaaccaacccaattctgcgattttatcagtaggtactatt
gtagagaagccagtggttaaaaaaggtgaaattgtagtaggacacaccatgattttaact
ttagcttgtgatcacaggactgtagatggagccacgggagcaaaattcttacaaactctt
aaaatctatttagaaaatccagtgacaatgctcgcttag

DBGET integrated database retrieval system