KEGG   Psychroflexus torquis: P700755_002938Help
Entry
P700755_002938    CDS       T02275                                 

Definition
(GenBank) selenocysteine lyase/cysteine desulfurase, SufS family
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00380  Tryptophan metabolism
ptq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    P700755_002938
Enzymes [BR:ptq01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     P700755_002938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AFU69641
UniProt: K4IKM2
LinkDB All DBs
Position
complement(3129162..3130430)
Genome map
AA seq 422 aa AA seqDB search
MKYLNTKVFAEQLDEADPLRAYRSEFLFPKAKDGSTKVYLCGNSLGLQPKQTSAFIQQEL
QDWANLGVEGHSHATHPWMTSNEDLAGSMAKIVGALPQEVVIMNTLTVNLHLMMVSFYKP
TPKRFKIVIESDAFPSDIYAVKSQLKFHNIDPQEGLLLWKPRPGEHLCRTEDFEHIVKEH
GNEIALVMIGSTNYYSGQAYDLKRITEVSKTKDITVGFDLAHGAGNIQPNLHNIGADFAV
WCTYKYLNSGPGSLGGCFIHEKHIADEHINRFVGWWGHNKDSRFNMRVDFDPIPTADGWQ
LSNPPILSLAGTRSSLDLFDKAGFDNIRKKSVLLTGFLEFLIDDLDMEEISILTPRSPEE
RGCQLSIQVKNANKSLFHQLMDKGVVADWREPDVIRIAPAPLYNSYTDVFTFVQILKNCL
YA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatctaaacactaaagtatttgcagaacaactagacgaggctgatccgctgaga
gcctatcgatctgagtttctttttcctaaggcgaaagatggctctacaaaagtttatttg
tgtgggaattcgctaggactccaacctaaacaaacctctgcttttattcagcaagaatta
caagactgggcaaatctaggcgtagaaggtcatagccatgcaacacatccgtggatgacc
tctaatgaggacctcgctggatcaatggctaaaatagttggtgctctaccccaagaagtg
gtcattatgaataccctcacggtgaacctacacctcatgatggtttctttttataagcca
actcccaaaaggtttaagatcgtcatagaaagtgatgcttttccgtctgacatatatgcc
gtaaaatctcaattaaaatttcataatatagatcctcaagagggactgctattatggaaa
ccgagacctggtgagcatctctgcagaacagaagattttgaacacattgtcaaggaacac
ggcaatgagattgctttggtgatgataggcagtaccaattattattctggtcaagcttat
gatttaaaacgaattacagaggtgtcgaaaacaaaggacatcaccgttggttttgacttg
gcgcacggagctggaaacatccaacccaatttgcacaacattggtgccgactttgccgtg
tggtgcacctataagtacctcaactctgggcctggaagtttaggcggttgttttatacat
gaaaaacatattgccgatgagcatatcaatcgcttcgtaggatggtgggggcataacaaa
gactcgcggtttaatatgcgggtagacttcgaccctattccaaccgctgacggatggcaa
ttgagcaatccgccaattctatctttagcggggactcgatcatctttggatctttttgat
aaagcaggctttgacaacattagaaaaaaatctgtgcttttaactggttttctggaattt
ctcatcgatgatttagacatggaggagatttcaattttaaccccgaggtcccctgaagaa
aggggttgccaattgtctatacaagttaaaaatgctaataaatcactattccatcaattg
atggacaaaggtgtggtggcagactggagagaacctgatgtgatccggatcgctcctgct
ccactctataattcttatacggatgtattcacctttgtacaaattttaaaaaactgctta
tatgcttaa

DBGET integrated database retrieval system