KEGG   Pan troglodytes (chimpanzee): 100608816
Entry
100608816         CDS       T01005                                 

Gene name
MAMU-DMA
Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain isoform X1
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100608816 (MAMU-DMA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100608816 (MAMU-DMA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100608816 (MAMU-DMA)
   04612 Antigen processing and presentation
    100608816 (MAMU-DMA)
   04658 Th1 and Th2 cell differentiation
    100608816 (MAMU-DMA)
   04659 Th17 cell differentiation
    100608816 (MAMU-DMA)
   04672 Intestinal immune network for IgA production
    100608816 (MAMU-DMA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100608816 (MAMU-DMA)
   05322 Systemic lupus erythematosus
    100608816 (MAMU-DMA)
   05323 Rheumatoid arthritis
    100608816 (MAMU-DMA)
   05320 Autoimmune thyroid disease
    100608816 (MAMU-DMA)
   05321 Inflammatory bowel disease
    100608816 (MAMU-DMA)
   05330 Allograft rejection
    100608816 (MAMU-DMA)
   05332 Graft-versus-host disease
    100608816 (MAMU-DMA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100608816 (MAMU-DMA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100608816 (MAMU-DMA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100608816 (MAMU-DMA)
   05152 Tuberculosis
    100608816 (MAMU-DMA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100608816 (MAMU-DMA)
   05164 Influenza A
    100608816 (MAMU-DMA)
   05168 Herpes simplex virus 1 infection
    100608816 (MAMU-DMA)
   05169 Epstein-Barr virus infection
    100608816 (MAMU-DMA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100608816 (MAMU-DMA)
   05140 Leishmaniasis
    100608816 (MAMU-DMA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    100608816 (MAMU-DMA)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100608816 (MAMU-DMA)
  Exosomal proteins of epithelial cells
   100608816 (MAMU-DMA)
  Exosomal proteins of breast milk
   100608816 (MAMU-DMA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6 FAST_1
Other DBs
NCBI-GeneID: 100608816
NCBI-ProteinID: XP_024212896
Ensembl: ENSPTRG00000018026
LinkDB
Position
6
AA seq 368 aa
MTRAPIGNDLAKHDLRPPSGGGSWGSWVGWVGSSYLLCGEKVWVMNRTKELRCYRCYHFC
GCYPTPGPSLKVSCWLSDSCQELQRRGIILCSYGVTSSSAVFERPGRLRNRRHFERRLVP
MKWLKKCLDTAPTPMWRDDLQNHTFLHTVYCQDGSPGVGLSEAYDEDQLFFFDFSQNTRV
PRLPEFADWAQEQGDAPAILFDKEFCESMIQQIGPKVDGKIPVSRGFPVAEVFTLKPLEF
GKPNTLVCFVSNLFPPMLTVNWQHHSIPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDI
FSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCS
GEAALRNI
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgacaagggcacctattggaaatgatctggcaaaacatgatctaaggccaccctctggg
ggagggagttggggaagctgggttggctgggttggtagctcctacctactgtgtggcgag
aaggtatgggtcatgaacagaaccaaggagctgcgctgctacagatgctaccacttctgt
ggctgctaccccactcctgggccgtccctgaaggtttcctgctggctgagcgattcctgc
caagagcttcaaagaagagggattattttatgcagttatggggtcacttcttccagtgct
gtctttgagaggcctggtaggttaaggaacagaagacattttgagagacgcttggtgcca
atgaagtggctgaagaaatgtctggatacagctcctactccaatgtggcgagatgacctg
caaaaccacacattcctgcacacagtgtactgccaggatgggagtcccggtgtgggactg
tctgaggcctacgacgaggaccagcttttcttcttcgacttttcccagaacactcgggtg
cctcgcctgcccgaatttgctgactgggctcaggaacagggagatgctcctgccatttta
tttgacaaagagttctgcgagtcgatgatccagcaaatagggccaaaagttgatgggaaa
atcccggtgtccagagggtttcctgtcgctgaagtgttcacgctgaagcccctggagttt
ggcaagcccaacactttggtctgttttgtcagtaatctcttcccacccatgctgacagtg
aactggcagcatcattccatccctgtggaaggatttgggcctacttttgtctcagctgtc
gatggactcagcttccaggccttttcttacttaaacttcacaccagaaccttctgacatt
ttctcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtgccc
cggaacgcactgccctcagatctgctggagaatgtgctgtgtggtgtggcctttggcctg
ggtgtgctgggcatcatcgtgggcattgttctcatcatctacttccggaagccttgctca
ggtgaggctgccctgaggaacatataa

KEGG   Pan troglodytes (chimpanzee): 100610904
Entry
100610904         CDS       T01005                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain-like isoform X3
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100610904
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100610904
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100610904
   04612 Antigen processing and presentation
    100610904
   04658 Th1 and Th2 cell differentiation
    100610904
   04659 Th17 cell differentiation
    100610904
   04672 Intestinal immune network for IgA production
    100610904
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100610904
   05322 Systemic lupus erythematosus
    100610904
   05323 Rheumatoid arthritis
    100610904
   05320 Autoimmune thyroid disease
    100610904
   05321 Inflammatory bowel disease
    100610904
   05330 Allograft rejection
    100610904
   05332 Graft-versus-host disease
    100610904
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100610904
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100610904
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100610904
   05152 Tuberculosis
    100610904
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100610904
   05164 Influenza A
    100610904
   05168 Herpes simplex virus 1 infection
    100610904
   05169 Epstein-Barr virus infection
    100610904
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100610904
   05140 Leishmaniasis
    100610904
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    100610904
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100610904
  Exosomal proteins of epithelial cells
   100610904
  Exosomal proteins of breast milk
   100610904
SSDB
Motif
Pfam: MHC_II_beta RasGAP
Other DBs
NCBI-GeneID: 100610904
NCBI-ProteinID: XP_016810734
LinkDB
Position
6
AA seq 165 aa
MMILQVSGGPWTVALTALLMVLCISVVQSRATPENSVYQEWQECYAFNGTQRVVDGLIYN
REEYVHFDSAVGEFLAVMELGRPIGEYFNSQKDFMERKRAEVDKVCRHKYELMEPLIRQR
RGTKDVTQKTWALSSSCLKSKIQRDKEKKIATCVFYFVFFNFLFP
NT seq 498 nt   +upstreamnt  +downstreamnt
atgatgatcctgcaggtttcagggggcccctggacagtggctctgacagcattactgatg
gtgctgtgcatatctgtggtccagagcagggccactccagagaattccgtctaccaggaa
tggcaggaatgctatgcgttcaatgggactcagcgcgttgtggacgggctcatctacaac
cgggaggaatacgtgcattttgacagcgcagtgggggagttcctagcagtgatggagctg
gggcggcccataggcgagtacttcaatagccagaaggactttatggaacggaagcgagcc
gaggtggacaaggtgtgcagacacaagtacgagctgatggagccactcatccggcagcgc
cgaggcactaaggatgtaactcagaagacctgggccttgtcctcaagctgcttgaaatcc
aaaatccaaagagacaaagaaaagaagattgctacatgtgtattttattttgtgtttttt
aattttttatttccatag

KEGG   Pan troglodytes (chimpanzee): 100616520
Entry
100616520         CDS       T01005                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain isoform X3
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100616520
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100616520
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100616520
   04612 Antigen processing and presentation
    100616520
   04658 Th1 and Th2 cell differentiation
    100616520
   04659 Th17 cell differentiation
    100616520
   04672 Intestinal immune network for IgA production
    100616520
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100616520
   05322 Systemic lupus erythematosus
    100616520
   05323 Rheumatoid arthritis
    100616520
   05320 Autoimmune thyroid disease
    100616520
   05321 Inflammatory bowel disease
    100616520
   05330 Allograft rejection
    100616520
   05332 Graft-versus-host disease
    100616520
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100616520
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100616520
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100616520
   05152 Tuberculosis
    100616520
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100616520
   05164 Influenza A
    100616520
   05168 Herpes simplex virus 1 infection
    100616520
   05169 Epstein-Barr virus infection
    100616520
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100616520
   05140 Leishmaniasis
    100616520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    100616520
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100616520
  Exosomal proteins of epithelial cells
   100616520
  Exosomal proteins of breast milk
   100616520
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig Ig_2 MHC_I
Other DBs
NCBI-GeneID: 100616520
NCBI-ProteinID: XP_003339166
Ensembl: ENSPTRG00000018018
UniProt: H2QSR6
LinkDB
Position
6
AA seq 261 aa
MSWKKALRIPGGLRAATVTLVLAMLSTPVAEGRDSPEDFVYQFKGMCYFTNGTERVRLVT
RYIYNREEYVRFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELR
TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETTGVVSTPLI
RNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGVGGFVL
GLIFLGLGLIIHHRSQKGLLH
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtcttggaaaaaggctttgcggatccccggaggccttcgggcagcaactgtgaccttg
gtgctggcgatgctgagcaccccagtagctgagggcagagactctcccgaggatttcgtg
taccagtttaagggcatgtgctacttcaccaacgggacggagcgcgtgcgtcttgtgacg
agatacatctataaccgagaggagtacgtgcgcttcgacagcgacgtgggggtgtaccgg
gcggtgacgccgctggggccgcctgccgccgagtactggaacagccagaaggaagtcctg
gagaggacccgggcggagttggacacggtgtgcagacacaactaccagttggagctccgc
acgaccttgcagcggcgagtggagcccacagtgaccatctccccatccaggacagaggcc
ctcaaccaccacaacctgctggtctgctcagtgacagatttctatccaggccagatcaaa
gtccgatggtttcggaatgaccaggaggagacaaccggcgttgtgtccaccccccttatt
aggaacggtgactggaccttccagatcctggtgatgctggaaatgactccccagcatgga
gatgtctacacctgccacgtggagcaccccagcctccagaaccccatcaccgtggagtgg
cgggctcagtctgaatctgcccagagcaagatgctgagtggcgttggaggcttcgtgctg
gggctgatcttcctcgggctgggccttattatccatcacaggagtcagaaagggctcctg
cactga

KEGG   Pan troglodytes (chimpanzee): 104006793
Entry
104006793         CDS       T01005                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR beta 3 chain precursor
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104006793
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104006793
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104006793
   04612 Antigen processing and presentation
    104006793
   04658 Th1 and Th2 cell differentiation
    104006793
   04659 Th17 cell differentiation
    104006793
   04672 Intestinal immune network for IgA production
    104006793
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    104006793
   05322 Systemic lupus erythematosus
    104006793
   05323 Rheumatoid arthritis
    104006793
   05320 Autoimmune thyroid disease
    104006793
   05321 Inflammatory bowel disease
    104006793
   05330 Allograft rejection
    104006793
   05332 Graft-versus-host disease
    104006793
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104006793
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104006793
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    104006793
   05152 Tuberculosis
    104006793
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104006793
   05164 Influenza A
    104006793
   05168 Herpes simplex virus 1 infection
    104006793
   05169 Epstein-Barr virus infection
    104006793
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104006793
   05140 Leishmaniasis
    104006793
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    104006793
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104006793
  Exosomal proteins of epithelial cells
   104006793
  Exosomal proteins of breast milk
   104006793
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 MHC_I DUF202
Other DBs
NCBI-GeneID: 104006793
NCBI-ProteinID: NP_001289348
Ensembl: ENSPTRG00000018001
UniProt: D5G3S4
LinkDB
Position
6
AA seq 266 aa
MVCLKLPGGSCMAALTVTLMVLSSPLALSGDTRPRFLELVKSECHFFNGTERVRFLERYF
YNQEEYVRFDSDVGEYRAVTEPGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGAVESFTV
QRRVHPQVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTEFLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtatgtctgaagctccctggaggctcctgcatggcagcgctgacagtgacactgatg
gtgctgagctccccactggctttgtctggggacacccgaccacgtttcttggagctggtt
aagtctgagtgtcatttcttcaatgggacggagcgggtgcggttcctggagagatacttc
tataaccaggaggagtacgtgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagccggggcggcctgtcgccgagtcctggaacagccagaaggacctcctggagcagaag
cggggccaggtggacaattactgcagacacaactacggggctgtggagagcttcacagtg
cagcggcgagtccatcctcaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaggtcaggtgg
ttccggaacggccaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagaccctggtgatgctagaaacagttcctcggagtggagaggtttac
acctgccaagtggaacacccaagtgtgatgagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacagaattcctgagctga

KEGG   Pan troglodytes (chimpanzee): 449592
Entry
449592            CDS       T01005                                 

Gene name
PATR-DMB
Definition
(RefSeq) major histocompatibility complex, class II, DM beta precursor
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    449592 (PATR-DMB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    449592 (PATR-DMB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    449592 (PATR-DMB)
   04612 Antigen processing and presentation
    449592 (PATR-DMB)
   04658 Th1 and Th2 cell differentiation
    449592 (PATR-DMB)
   04659 Th17 cell differentiation
    449592 (PATR-DMB)
   04672 Intestinal immune network for IgA production
    449592 (PATR-DMB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    449592 (PATR-DMB)
   05322 Systemic lupus erythematosus
    449592 (PATR-DMB)
   05323 Rheumatoid arthritis
    449592 (PATR-DMB)
   05320 Autoimmune thyroid disease
    449592 (PATR-DMB)
   05321 Inflammatory bowel disease
    449592 (PATR-DMB)
   05330 Allograft rejection
    449592 (PATR-DMB)
   05332 Graft-versus-host disease
    449592 (PATR-DMB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    449592 (PATR-DMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    449592 (PATR-DMB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    449592 (PATR-DMB)
   05152 Tuberculosis
    449592 (PATR-DMB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    449592 (PATR-DMB)
   05164 Influenza A
    449592 (PATR-DMB)
   05168 Herpes simplex virus 1 infection
    449592 (PATR-DMB)
   05169 Epstein-Barr virus infection
    449592 (PATR-DMB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    449592 (PATR-DMB)
   05140 Leishmaniasis
    449592 (PATR-DMB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    449592 (PATR-DMB)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   449592 (PATR-DMB)
  Exosomal proteins of epithelial cells
   449592 (PATR-DMB)
  Exosomal proteins of breast milk
   449592 (PATR-DMB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set ig
Other DBs
NCBI-GeneID: 449592
NCBI-ProteinID: NP_001127814
Ensembl: ENSPTRG00000018025
UniProt: A0A663D8M8 H2QSS0
LinkDB
Position
6
AA seq 263 aa
MITFLPLLLGLSLGCTGAGGFVAHVESSCLLDDAGTPKDFTYCISFNKDLLTCWDPEENK
MAPCEFGVLNSLANFLSQHLNQQDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVA
KTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHL
ALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISW
RRAGHSSYTPLPGSNYSEGRHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgatcacattcctgccgctgctgctggggctcagcctgggctgcacaggagcaggtggc
ttcgtggcccacgtggaaagctcctgtctgttggatgatgctgggactccaaaggatttc
acatactgcatctccttcaacaaggatctgctgacctgctgggatccagaggagaataag
atggccccttgcgaatttggggtgctgaatagcttggcgaatttcctctcacagcacctc
aaccaacaagacaccctgatgcagcgcttgcgcaatgggcttcagaattgtgccacacac
acccagcccttctggggatcactgaccaacaggacacggccaccatctgtgcaagtagcc
aaaaccactccttttaacacgagggagcctgtgatgctggcctgctatgtgtggggcttc
tatccagcagaagtgaccatcacgtggaggaagaacgggaagcttgtcatgcctcacagc
agtgcgcacaagactgcccagcccaatggagactggacataccagaccctctcccattta
gccttaaccccctcttacggggacacttacacctgtgtggtagagcacattggggctcct
gagcccatccttcgggactggacacctgggctgtcccccatgcagaccctgaaggtttct
gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtgtgatcagctgg
cggagagctggccactctagttacactcctcttcctgggtccaattattcagaaggacgg
cacatttcctag

KEGG   Pan troglodytes (chimpanzee): 462591
Entry
462591            CDS       T01005                                 

Gene name
PATR-DRA
Definition
(RefSeq) major histocompatibility complex, class II, DR alpha precursor
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    462591 (PATR-DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    462591 (PATR-DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    462591 (PATR-DRA)
   04612 Antigen processing and presentation
    462591 (PATR-DRA)
   04658 Th1 and Th2 cell differentiation
    462591 (PATR-DRA)
   04659 Th17 cell differentiation
    462591 (PATR-DRA)
   04672 Intestinal immune network for IgA production
    462591 (PATR-DRA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    462591 (PATR-DRA)
   05322 Systemic lupus erythematosus
    462591 (PATR-DRA)
   05323 Rheumatoid arthritis
    462591 (PATR-DRA)
   05320 Autoimmune thyroid disease
    462591 (PATR-DRA)
   05321 Inflammatory bowel disease
    462591 (PATR-DRA)
   05330 Allograft rejection
    462591 (PATR-DRA)
   05332 Graft-versus-host disease
    462591 (PATR-DRA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    462591 (PATR-DRA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    462591 (PATR-DRA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    462591 (PATR-DRA)
   05152 Tuberculosis
    462591 (PATR-DRA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    462591 (PATR-DRA)
   05164 Influenza A
    462591 (PATR-DRA)
   05168 Herpes simplex virus 1 infection
    462591 (PATR-DRA)
   05169 Epstein-Barr virus infection
    462591 (PATR-DRA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    462591 (PATR-DRA)
   05140 Leishmaniasis
    462591 (PATR-DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    462591 (PATR-DRA)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   462591 (PATR-DRA)
  Exosomal proteins of epithelial cells
   462591 (PATR-DRA)
  Exosomal proteins of breast milk
   462591 (PATR-DRA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 462591
NCBI-ProteinID: NP_001127811
Ensembl: ENSPTRG00000018016
UniProt: H2QSR4 A0A663DI41
LinkDB
Position
6
AA seq 254 aa
MAVSGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
PVELREPNILICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
GVRKSNAAERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccgtaagtggagtccctgtgctaggatttttcatcatagctgtgctgatgagcgct
caggaatcatgggctatcaaagaagaacatgtgatcatccaggccgagttctatctgaat
cctgaccaatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggcaaagaaggagacggtctggcggcttgaagaatttggacgatttgccagctttgag
gctcaaggtgcattggccaacatagctgtggacaaagccaacctggaaatcatgacaaag
cgctccaactatactccgatcaccaatgtacctccagaggtaactgtgctcacaaacagc
cctgtggaactgagagagcccaacatcctcatctgtttcatcgacaagttcaccccacca
gtggtcaatgtcacgtggcttcgaaatggaaaacctgtcaccacaggagtgtcagagaca
gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccccttcctgccc
tcaactgaggacgtttacgactgcagggtggaacactggggcttggatgagcctcttctc
aagcactgggagtttgatgctccaagccctctcccagagactacagagaacgtggtgtgt
gccctgggcctgactgtgggtctggtgggcatcatcattgggaccatcttcatcatcaag
ggtgtgcgcaaaagcaatgcagcagaacgcagggggcctctgtga

KEGG   Pan troglodytes (chimpanzee): 462592
Entry
462592            CDS       T01005                                 

Gene name
PATR-DRB5
Definition
(RefSeq) major histocompatibility complex, class II, DR beta 5 precursor
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    462592 (PATR-DRB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    462592 (PATR-DRB5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    462592 (PATR-DRB5)
   04612 Antigen processing and presentation
    462592 (PATR-DRB5)
   04658 Th1 and Th2 cell differentiation
    462592 (PATR-DRB5)
   04659 Th17 cell differentiation
    462592 (PATR-DRB5)
   04672 Intestinal immune network for IgA production
    462592 (PATR-DRB5)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    462592 (PATR-DRB5)
   05322 Systemic lupus erythematosus
    462592 (PATR-DRB5)
   05323 Rheumatoid arthritis
    462592 (PATR-DRB5)
   05320 Autoimmune thyroid disease
    462592 (PATR-DRB5)
   05321 Inflammatory bowel disease
    462592 (PATR-DRB5)
   05330 Allograft rejection
    462592 (PATR-DRB5)
   05332 Graft-versus-host disease
    462592 (PATR-DRB5)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    462592 (PATR-DRB5)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    462592 (PATR-DRB5)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    462592 (PATR-DRB5)
   05152 Tuberculosis
    462592 (PATR-DRB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    462592 (PATR-DRB5)
   05164 Influenza A
    462592 (PATR-DRB5)
   05168 Herpes simplex virus 1 infection
    462592 (PATR-DRB5)
   05169 Epstein-Barr virus infection
    462592 (PATR-DRB5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    462592 (PATR-DRB5)
   05140 Leishmaniasis
    462592 (PATR-DRB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    462592 (PATR-DRB5)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   462592 (PATR-DRB5)
  Exosomal proteins of epithelial cells
   462592 (PATR-DRB5)
  Exosomal proteins of breast milk
   462592 (PATR-DRB5)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 Marek_A
Other DBs
NCBI-GeneID: 462592
NCBI-ProteinID: NP_001266704
Ensembl: ENSPTRG00000023735
UniProt: D5G3T5
LinkDB
Position
6
AA seq 266 aa
MVCLKLPGGSYMAVLTVTLIVLSSPLALAGDTRPRFLKQDKYECHFFNGTERVRFLHRYF
YNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDILERRRAEVDTYCRHNYGVLESFTV
QRRVHPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQILVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFKNQKGHSGLHPTGLVS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggttcctacatggcagtgctgacagtgacactgata
gtgctgagctccccactggctttggctggggacacccgaccacgtttcttgaagcaggat
aagtatgagtgtcatttcttcaacgggacggagcgggtgcggttcctgcacagatacttc
tataaccaagaggaggacttgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgacgcggagtactggaacagccagaaggacatcctggagcggagg
cgcgccgaggtggacacctactgcagacacaactacggggttttagagagcttcacagtg
cagcggcgagtccaccctaaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg
ttccggaatggccaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagattctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcacccaagcgtgacgagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaagaatcagaaagggcactctggacttcac
ccaacaggactcgtgagctga

KEGG   Pan troglodytes (chimpanzee): 462594
Entry
462594            CDS       T01005                                 

Gene name
PATR-DQB1
Definition
(RefSeq) major histocompatibility complex, class II, DQ beta 1 precursor
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    462594 (PATR-DQB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    462594 (PATR-DQB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    462594 (PATR-DQB1)
   04612 Antigen processing and presentation
    462594 (PATR-DQB1)
   04658 Th1 and Th2 cell differentiation
    462594 (PATR-DQB1)
   04659 Th17 cell differentiation
    462594 (PATR-DQB1)
   04672 Intestinal immune network for IgA production
    462594 (PATR-DQB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    462594 (PATR-DQB1)
   05322 Systemic lupus erythematosus
    462594 (PATR-DQB1)
   05323 Rheumatoid arthritis
    462594 (PATR-DQB1)
   05320 Autoimmune thyroid disease
    462594 (PATR-DQB1)
   05321 Inflammatory bowel disease
    462594 (PATR-DQB1)
   05330 Allograft rejection
    462594 (PATR-DQB1)
   05332 Graft-versus-host disease
    462594 (PATR-DQB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    462594 (PATR-DQB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    462594 (PATR-DQB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    462594 (PATR-DQB1)
   05152 Tuberculosis
    462594 (PATR-DQB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    462594 (PATR-DQB1)
   05164 Influenza A
    462594 (PATR-DQB1)
   05168 Herpes simplex virus 1 infection
    462594 (PATR-DQB1)
   05169 Epstein-Barr virus infection
    462594 (PATR-DQB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    462594 (PATR-DQB1)
   05140 Leishmaniasis
    462594 (PATR-DQB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    462594 (PATR-DQB1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   462594 (PATR-DQB1)
  Exosomal proteins of epithelial cells
   462594 (PATR-DQB1)
  Exosomal proteins of breast milk
   462594 (PATR-DQB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 MHC_I DUF202 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 462594
NCBI-ProteinID: NP_001258000
Ensembl: ENSPTRG00000018001
UniProt: H2RAS7
LinkDB
Position
6
AA seq 266 aa
MLCLKLPGVSCMTALTVTLMVLSSPLALAGDTRSRFLLQPKGECHFFNGTERVRFLHRYF
YNQEEFMRFDSDVGEYRAVTELGRPVAEYCNSQKDILEQARAAVDNYCRHNYGVGESFTV
QRRVQPKVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atgctgtgtctgaagctccctggagtctcctgcatgacagcactgacagtgacactgatg
gtgctgagctcaccactggctttggctggggacacccgatcacgtttcctgttgcagcct
aagggggagtgtcatttcttcaatgggacggagcgggtgcggttcctgcacagatacttc
tataaccaagaggagttcatgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgtcgccgagtactgcaacagccagaaggacatcctggagcaggcg
cgggccgcggtggacaattactgcagacacaactacggggttggtgagagcttcacagtg
cagcggcgagtccaacctaaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgagtggtttctatccaggcagcattgaagtcaggtgg
ttcctgaatggccaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcacccaagcgtgacgagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggtgtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacaggattcctgagctga

KEGG   Pan troglodytes (chimpanzee): 462598
Entry
462598            CDS       T01005                                 

Gene name
PATR-DPA1
Definition
(RefSeq) HLA class II histocompatibility antigen, DP alpha 1 chain isoform X1
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    462598 (PATR-DPA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    462598 (PATR-DPA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    462598 (PATR-DPA1)
   04612 Antigen processing and presentation
    462598 (PATR-DPA1)
   04658 Th1 and Th2 cell differentiation
    462598 (PATR-DPA1)
   04659 Th17 cell differentiation
    462598 (PATR-DPA1)
   04672 Intestinal immune network for IgA production
    462598 (PATR-DPA1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    462598 (PATR-DPA1)
   05322 Systemic lupus erythematosus
    462598 (PATR-DPA1)
   05323 Rheumatoid arthritis
    462598 (PATR-DPA1)
   05320 Autoimmune thyroid disease
    462598 (PATR-DPA1)
   05321 Inflammatory bowel disease
    462598 (PATR-DPA1)
   05330 Allograft rejection
    462598 (PATR-DPA1)
   05332 Graft-versus-host disease
    462598 (PATR-DPA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    462598 (PATR-DPA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    462598 (PATR-DPA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    462598 (PATR-DPA1)
   05152 Tuberculosis
    462598 (PATR-DPA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    462598 (PATR-DPA1)
   05164 Influenza A
    462598 (PATR-DPA1)
   05168 Herpes simplex virus 1 infection
    462598 (PATR-DPA1)
   05169 Epstein-Barr virus infection
    462598 (PATR-DPA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    462598 (PATR-DPA1)
   05140 Leishmaniasis
    462598 (PATR-DPA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    462598 (PATR-DPA1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   462598 (PATR-DPA1)
  Exosomal proteins of epithelial cells
   462598 (PATR-DPA1)
  Exosomal proteins of breast milk
   462598 (PATR-DPA1)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 462598
NCBI-ProteinID: XP_009449274
Ensembl: ENSPTRG00000018029
UniProt: H2QSS4 A0A663D5P0
LinkDB
Position
6
AA seq 260 aa
MRPEDRMFHIRAVIFRALSLAFLLSLRGAGAIKADHVSTYAMFVQTHRPTGEFMFEFDED
EMFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNILIQRSNHTQAANDPPEV
TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDFYDCKVEHWGLDQPLLKHWEAQEPIQMPETRETVLCALGLVLGLVGIIVG
TILIIKSLRSGRDPRAQGPL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcgccctgaagacagaatgttccatatcagagctgtgatcttcagggccctctccttg
gctttcctgctgagtctccgaggagctggggccatcaaggcggaccatgtgtcaacttat
gccatgtttgtacagacccatagaccaacaggggagtttatgtttgaatttgatgaagat
gagatgttctatgtggatctggacaagaaggagaccgtctggcatctggaggagtttggc
cgagccttttcctttgaggctcagggcgggctggctaacattgctatattgaacaacaac
ttgaatatcttgatccagcgttccaaccacactcaggccgccaatgatccccctgaggtg
accgtgtttcccaaggagcctgtggagctgggccagcccaacaccctcatctgccacatt
gacaagttcttcccaccagtgctcaacgtcacgtggctgtgcaacggggagccggtcact
gagggtgtcgctgagagcctcttcctgcccagaacagattacagcttccacaagttccac
tacctgacctttgtgccctcagcagaggacttctatgactgcaaggtggagcactggggc
ttggaccagccgctcctcaagcactgggaggcccaagagccaatccagatgcctgagaca
agggagactgtgctctgtgccctgggcctggtgctgggcctagtgggcatcatcgtgggc
accatcctcatcataaagtctctgcgttctggccgtgacccccgggcccaggggcccctg
tga

KEGG   Pan troglodytes (chimpanzee): 462599
Entry
462599            CDS       T01005                                 

Gene name
PATR-DPB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    462599 (PATR-DPB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    462599 (PATR-DPB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    462599 (PATR-DPB1)
   04612 Antigen processing and presentation
    462599 (PATR-DPB1)
   04658 Th1 and Th2 cell differentiation
    462599 (PATR-DPB1)
   04659 Th17 cell differentiation
    462599 (PATR-DPB1)
   04672 Intestinal immune network for IgA production
    462599 (PATR-DPB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    462599 (PATR-DPB1)
   05322 Systemic lupus erythematosus
    462599 (PATR-DPB1)
   05323 Rheumatoid arthritis
    462599 (PATR-DPB1)
   05320 Autoimmune thyroid disease
    462599 (PATR-DPB1)
   05321 Inflammatory bowel disease
    462599 (PATR-DPB1)
   05330 Allograft rejection
    462599 (PATR-DPB1)
   05332 Graft-versus-host disease
    462599 (PATR-DPB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    462599 (PATR-DPB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    462599 (PATR-DPB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    462599 (PATR-DPB1)
   05152 Tuberculosis
    462599 (PATR-DPB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    462599 (PATR-DPB1)
   05164 Influenza A
    462599 (PATR-DPB1)
   05168 Herpes simplex virus 1 infection
    462599 (PATR-DPB1)
   05169 Epstein-Barr virus infection
    462599 (PATR-DPB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    462599 (PATR-DPB1)
   05140 Leishmaniasis
    462599 (PATR-DPB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    462599 (PATR-DPB1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   462599 (PATR-DPB1)
  Exosomal proteins of epithelial cells
   462599 (PATR-DPB1)
  Exosomal proteins of breast milk
   462599 (PATR-DPB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Marek_A ig C2-set_2
Other DBs
NCBI-GeneID: 462599
NCBI-ProteinID: XP_518391
Ensembl: ENSPTRG00000018030
UniProt: H2RC77 A0A663DDV7
LinkDB
Position
6
AA seq 258 aa
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQGRQECYAFNGTQRYLERYIYN
REEYARFDSDVGEFRAVTELGRPAAEYWNSQKDLLEEKRAVPDRMCRHNYELNEAVTLQR
RVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
NT seq 777 nt   +upstreamnt  +downstreamnt
atgatggttctgcaggtttctgcggccccccggacagtggctctgacggcgttactgatg
gtgctgctcacatctgtggtccagggcagggccactccagagaattacgtgtaccaggga
cggcaggaatgctacgcgtttaatgggacacagcgctacctggagagatacatctacaac
cgggaggagtacgcgcgcttcgacagcgacgtgggggagttccgggcggtgacggagctg
gggcggcctgctgcggagtactggaacagccagaaggacctcctggaggagaagcgggca
gtgccggacaggatgtgcagacacaactacgagctgaacgaggccgtgaccctgcagcgc
cgagtccagcctaaggtgaacgtttccccctccaagaaggggcccctgcagcaccacaac
ctgcttgtctgccacgtgacagatttctacccaggcagcattcaagtccgatggttcctg
aatggacaggaggaaacagctggggtcgtgtccaccaacctgatccgtaatggagactgg
accttccagatcctggtgatgctggaaatgaccccccagcagggagacgtctacatctgc
caagtggagcacaccagcctggacagtcctgtcaccgtggagtggaaggcacagtctgat
tctgcccgaagtaagacattgacgggagctgggggcttcgtgctggggctcatcatctgt
ggagtgggcatcttcatgcacaggaggagcaagaaagttcaacgaggatctgcataa

KEGG   Pan troglodytes (chimpanzee): 471974
Entry
471974            CDS       T01005                                 

Gene name
PATR-DQA1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    471974 (PATR-DQA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    471974 (PATR-DQA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    471974 (PATR-DQA1)
   04612 Antigen processing and presentation
    471974 (PATR-DQA1)
   04658 Th1 and Th2 cell differentiation
    471974 (PATR-DQA1)
   04659 Th17 cell differentiation
    471974 (PATR-DQA1)
   04672 Intestinal immune network for IgA production
    471974 (PATR-DQA1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    471974 (PATR-DQA1)
   05322 Systemic lupus erythematosus
    471974 (PATR-DQA1)
   05323 Rheumatoid arthritis
    471974 (PATR-DQA1)
   05320 Autoimmune thyroid disease
    471974 (PATR-DQA1)
   05321 Inflammatory bowel disease
    471974 (PATR-DQA1)
   05330 Allograft rejection
    471974 (PATR-DQA1)
   05332 Graft-versus-host disease
    471974 (PATR-DQA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    471974 (PATR-DQA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    471974 (PATR-DQA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    471974 (PATR-DQA1)
   05152 Tuberculosis
    471974 (PATR-DQA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    471974 (PATR-DQA1)
   05164 Influenza A
    471974 (PATR-DQA1)
   05168 Herpes simplex virus 1 infection
    471974 (PATR-DQA1)
   05169 Epstein-Barr virus infection
    471974 (PATR-DQA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    471974 (PATR-DQA1)
   05140 Leishmaniasis
    471974 (PATR-DQA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    471974 (PATR-DQA1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   471974 (PATR-DQA1)
  Exosomal proteins of epithelial cells
   471974 (PATR-DQA1)
  Exosomal proteins of breast milk
   471974 (PATR-DQA1)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 471974
NCBI-ProteinID: XP_003950844
Ensembl: ENSPTRG00000034186
UniProt: H2RBA7
LinkDB
Position
6
AA seq 255 aa
MILNKALLLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEEFYV
DLERKETVWQLPLFRSFRGFDPQGALTNIAITKHNLNILIKRSNSTAATNEVPEVTVFSK
SPVTLDQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETVVCTLGLSVGLVGIVVGTVLII
RGLRSVGASRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgccctgaccactgtgatgagccct
tgtggaggtgaagacattgtggctgaccacgttgcctcttacggtgtaaacttgtaccag
tcttacggtccctctgggcagtacacccatgaatttgatggagatgaggagttctatgtg
gacctggagaggaaggagactgtctggcagttgcctctgttccgcagctttagaggattt
gacccgcagggtgcgctgaccaacattgctattacaaaacacaacttgaacatcctgatt
aaacgctccaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaag
tctcccgtgacgctggatcagcccaacaccctcatctgtcttgtggacaacatctttcct
cctgtggtcaacatcacatggctgagcaatgggcactcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggatgagcctctt
ctgaaacactgggagcctgagattccagcacctatgtcagagctcacagagactgtggtc
tgcaccctggggttgtctgtgggcctcgtgggcattgtggtggggaccgtcttgatcatc
cgaggcctgcgttcagttggtgcttccagacaccaagggcccttgtga

KEGG   Pan troglodytes (chimpanzee): 471976
Entry
471976            CDS       T01005                                 

Gene name
PATR-DQA2
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    471976 (PATR-DQA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    471976 (PATR-DQA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    471976 (PATR-DQA2)
   04612 Antigen processing and presentation
    471976 (PATR-DQA2)
   04658 Th1 and Th2 cell differentiation
    471976 (PATR-DQA2)
   04659 Th17 cell differentiation
    471976 (PATR-DQA2)
   04672 Intestinal immune network for IgA production
    471976 (PATR-DQA2)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    471976 (PATR-DQA2)
   05322 Systemic lupus erythematosus
    471976 (PATR-DQA2)
   05323 Rheumatoid arthritis
    471976 (PATR-DQA2)
   05320 Autoimmune thyroid disease
    471976 (PATR-DQA2)
   05321 Inflammatory bowel disease
    471976 (PATR-DQA2)
   05330 Allograft rejection
    471976 (PATR-DQA2)
   05332 Graft-versus-host disease
    471976 (PATR-DQA2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    471976 (PATR-DQA2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    471976 (PATR-DQA2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    471976 (PATR-DQA2)
   05152 Tuberculosis
    471976 (PATR-DQA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    471976 (PATR-DQA2)
   05164 Influenza A
    471976 (PATR-DQA2)
   05168 Herpes simplex virus 1 infection
    471976 (PATR-DQA2)
   05169 Epstein-Barr virus infection
    471976 (PATR-DQA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    471976 (PATR-DQA2)
   05140 Leishmaniasis
    471976 (PATR-DQA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    471976 (PATR-DQA2)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   471976 (PATR-DQA2)
  Exosomal proteins of epithelial cells
   471976 (PATR-DQA2)
  Exosomal proteins of breast milk
   471976 (PATR-DQA2)
SSDB
Motif
Pfam: MHC_II_alpha C1-set C2-set_2 Ig_3 Marek_A WW
Other DBs
NCBI-GeneID: 471976
NCBI-ProteinID: XP_016810257
Ensembl: ENSPTRG00000018017
LinkDB
Position
6
AA seq 285 aa
MILNKALLLGALALTAVMSPCGGEDIVGSMSDSLLLYRHGQFFLPVFHPPACHLHSSADH
VASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQSALRNMA
VGKHTLEFMIKQSNSTAATNEVPEVTVFSKFPVTLDQPNTLICLVDNIFPPVVNITWLSN
GHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPA
PMSELTETLVCALGLSAGLMGIVVGTVFIIQGLHSVGASRHQGLL
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgccctgactgccgtgatgagcccc
tgtggaggtgaagacattgtgggatccatgtctgactccctgctcctttacagacacggg
cagttctttctccctgtgttccaccctcctgcttgtcaccttcactcatcagctgaccat
gttgcctcctatggtgtgaacttctaccagtctcacggtccctctggccagtacacccat
gaatttgatggagacgaggagttctacgtggacctggagacgaaagagactgtctggcag
ttgcctatgtttagcaaatttataagttttgacccgcagagtgcactgagaaatatggct
gtgggaaaacacaccttggaattcatgattaaacagtccaactctaccgctgccaccaat
gaggttcctgaggtcacagtgttttccaagtttcctgtgacgctggatcagcccaacacc
ctcatctgtcttgtggacaacatctttcctcctgtggtcaacatcacatggctgagcaat
gggcactcagtcacagaaggtgtttctgagaccagcttcctctccaagagtgatcattcc
ttcttcaagatcagttacctcaccttcctcccttctgctgatgagatttatgactgcaag
gtggaacactggggcctggacgagcctcttctgaaacactgggagcctgagattccagcc
cctatgtcagagctcacagagactttggtctgcgccctggggttgtctgcgggcctcatg
ggcattgtggtgggcactgtcttcatcatccaaggcctgcattcagttggtgcttccaga
caccaagggctcttgtga

KEGG   Pan troglodytes (chimpanzee): 471977
Entry
471977            CDS       T01005                                 

Gene name
PATR-DOB
Definition
(RefSeq) patr class II histocompatibility antigen, DO beta chain precursor
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    471977 (PATR-DOB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    471977 (PATR-DOB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    471977 (PATR-DOB)
   04612 Antigen processing and presentation
    471977 (PATR-DOB)
   04658 Th1 and Th2 cell differentiation
    471977 (PATR-DOB)
   04659 Th17 cell differentiation
    471977 (PATR-DOB)
   04672 Intestinal immune network for IgA production
    471977 (PATR-DOB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    471977 (PATR-DOB)
   05322 Systemic lupus erythematosus
    471977 (PATR-DOB)
   05323 Rheumatoid arthritis
    471977 (PATR-DOB)
   05320 Autoimmune thyroid disease
    471977 (PATR-DOB)
   05321 Inflammatory bowel disease
    471977 (PATR-DOB)
   05330 Allograft rejection
    471977 (PATR-DOB)
   05332 Graft-versus-host disease
    471977 (PATR-DOB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    471977 (PATR-DOB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    471977 (PATR-DOB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    471977 (PATR-DOB)
   05152 Tuberculosis
    471977 (PATR-DOB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    471977 (PATR-DOB)
   05164 Influenza A
    471977 (PATR-DOB)
   05168 Herpes simplex virus 1 infection
    471977 (PATR-DOB)
   05169 Epstein-Barr virus infection
    471977 (PATR-DOB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    471977 (PATR-DOB)
   05140 Leishmaniasis
    471977 (PATR-DOB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    471977 (PATR-DOB)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   471977 (PATR-DOB)
  Exosomal proteins of epithelial cells
   471977 (PATR-DOB)
  Exosomal proteins of breast milk
   471977 (PATR-DOB)
SSDB
Motif
Pfam: MHC_II_beta C1-set ig MHC_I C2-set_2
Other DBs
NCBI-GeneID: 471977
NCBI-ProteinID: NP_001123943
Ensembl: ENSPTRG00000018020
UniProt: P18467
LinkDB
Position
6
AA seq 273 aa
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIRWFLNGQEERARVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWKKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggttctgggtgggtcccctgggtggtggctctgctagtgaatctgacccgactggat
tcctccatgactcaaggcacagactctccagaagattttgtgattcaggcaaaggctgac
tgttacttcaccaacgggacagaaaaggtgcagtttgtggtcagattcatctttaacttg
gaggagtatgtacgtttcgacagtgatgtggggatgtttgtggcattgaccaagctgggg
cagccagatgctgagcagtggaacagccggctggatctcttggagaggagcagacaggcc
gtggatggggtctgtagacacaactacaggctgggcgcacccttcactgtggggagaaaa
gtgcaaccagaggtgacagtgtacccagagaggaccccactcctgcaccagcataatctg
ctgcactgctctgtgacaggcttctatccaggggatatcaagatcaggtggttcctgaat
gggcaggaggagagagctcgggtcatgtccaccggccctatcaggaatggagactggacc
tttcagactgtggtgatgctagaaatgactcctgaacttggacatgtctacacctgcctt
gtcgatcactccagcctgctgagccctgtttctgtggagtggagagctcagtctgaatat
tcttggaaaaagatgctgagtggcattgcagccttcctacttgggctaatcttccttctg
gtgggaatcgtcatccagctaagggctcagaaaggatatgtgaggacgcagatgtctggt
aatgaggtctcaagagctgttctgctccctcagtcatgctaa

KEGG   Pan troglodytes (chimpanzee): 471979
Entry
471979            CDS       T01005                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain isoform X1
  KO
K06752  MHC class II antigen
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05145  Toxoplasmosis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    471979
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    471979
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    471979
   04612 Antigen processing and presentation
    471979
   04658 Th1 and Th2 cell differentiation
    471979
   04659 Th17 cell differentiation
    471979
   04672 Intestinal immune network for IgA production
    471979
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    471979
   05322 Systemic lupus erythematosus
    471979
   05323 Rheumatoid arthritis
    471979
   05320 Autoimmune thyroid disease
    471979
   05321 Inflammatory bowel disease
    471979
   05330 Allograft rejection
    471979
   05332 Graft-versus-host disease
    471979
  09166 Cardiovascular disease
   05416 Viral myocarditis
    471979
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    471979
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    471979
   05152 Tuberculosis
    471979
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    471979
   05164 Influenza A
    471979
   05168 Herpes simplex virus 1 infection
    471979
   05169 Epstein-Barr virus infection
    471979
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    471979
   05140 Leishmaniasis
    471979
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    471979
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   471979
  Exosomal proteins of epithelial cells
   471979
  Exosomal proteins of breast milk
   471979
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Marek_A
Other DBs
NCBI-GeneID: 471979
NCBI-ProteinID: XP_009449272
Ensembl: ENSPTRG00000018028
LinkDB
Position
6
AA seq 265 aa
MALRAGLILGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDGEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPK
SRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFV
PSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVMILLREMTCG
RHPAYPHGFVTAPACSVPFKCIPLC
NT seq 798 nt   +upstreamnt  +downstreamnt
atggccctcagagcagggctgatcctggggttccacaccctgatgaccctcctgagcccg
caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag
tcttacggcgcctcgggccagttcacccatgaatttgatggggaacagctgttctctgtg
gacctgaagaaaagcgaggccgtgtggcgtctgcctgagtttggcgactttgcccgcttt
gacccgcagggcgggctggccggcatcgccgcaatcaaagcccatctggacatcctggtg
gagcgctccaaccgcagcagagccatcaacgtgcctccacgggtgaccgtgctccccaag
tctcgggtggagctgggccagcccaacatcctcatctgcatcgtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggccaaactgtcactgagggagtggcccag
accagcttctattcccagcctgaccatttgttccgcaagttccactacctgcccttcgtg
ccctcagctgaggacgtctatgactgccaggtggagcactggggcctggatgcaccactc
ctcaggcattgggagctccaggtgcctattccaccaccagatgccatggagaccctggtc
tgtgccctgggcctggccatcggcctggtaatgatccttctgagagaaatgacttgtggg
agacaccctgcatatcctcatgggtttgtgacagcccctgcatgctcagtgccttttaag
tgcatcccgctgtgctga

DBGET integrated database retrieval system