KEGG   Pan troglodytes (chimpanzee): 100608894
Entry
100608894         CDS       T01005                                 

Definition
(RefSeq) immunoglobulin heavy variable 3-23
  KO
K06856  immunoglobulin heavy chain
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04020  Calcium signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04145  Phagosome
ptr04151  PI3K-Akt signaling pathway
ptr04613  Neutrophil extracellular trap formation
ptr04640  Hematopoietic cell lineage
ptr04650  Natural killer cell mediated cytotoxicity
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04672  Intestinal immune network for IgA production
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05143  African trypanosomiasis
ptr05146  Amoebiasis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05169  Epstein-Barr virus infection
ptr05171  Coronavirus disease - COVID-19
ptr05202  Transcriptional misregulation in cancer
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05340  Primary immunodeficiency
ptr05414  Dilated cardiomyopathy
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100608894
   04020 Calcium signaling pathway
    100608894
   04072 Phospholipase D signaling pathway
    100608894
   04151 PI3K-Akt signaling pathway
    100608894
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100608894
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100608894
   04613 Neutrophil extracellular trap formation
    100608894
   04650 Natural killer cell mediated cytotoxicity
    100608894
   04662 B cell receptor signaling pathway
    100608894
   04664 Fc epsilon RI signaling pathway
    100608894
   04666 Fc gamma R-mediated phagocytosis
    100608894
   04672 Intestinal immune network for IgA production
    100608894
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100608894
  09163 Immune disease
   05310 Asthma
    100608894
   05322 Systemic lupus erythematosus
    100608894
   05323 Rheumatoid arthritis
    100608894
   05320 Autoimmune thyroid disease
    100608894
   05330 Allograft rejection
    100608894
   05340 Primary immunodeficiency
    100608894
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100608894
   05416 Viral myocarditis
    100608894
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100608894
   05150 Staphylococcus aureus infection
    100608894
   05152 Tuberculosis
    100608894
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100608894
   05169 Epstein-Barr virus infection
    100608894
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100608894
   05140 Leishmaniasis
    100608894
   05143 African trypanosomiasis
    100608894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    100608894
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100608894
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 100608894
NCBI-ProteinID: XP_016803304
LinkDB
Position
Unknown
AA seq 147 aa
MEFVLSWVFLVAILKGVQCEVQLVQSGGGLVQPGGSLRLSCAGSGFTFSSYAMHWVRQAP
GKGLEWVSAIGTGGGTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCARDTVR
GSQCEPRHKPLCRMLGGNQLWGAHRTH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggagtttgtgctgagctgggttttccttgttgctatattaaaaggtgtccagtgtgag
gttcagctagtgcagtctgggggaggcttggtacagcctggggggtccctgagactttcc
tgtgcaggctctggattcaccttcagtagctatgctatgcactgggttcgccaggctcca
ggaaaaggtctggagtgggtatcagctattggtactggtggtggcacatactatgcagac
tccgtgaagggccgattcaccatctccagagacaatgccaagaactccttgtatcttcaa
atgaacagcctgagagccgaggacatggctgtgtattactgtgcaagagacacagtgagg
ggaagtcagtgtgagcccagacacaaacctctctgcagaatgcttgggggaaatcagctg
tggggggcgcacaggacccactga

KEGG   Pan troglodytes (chimpanzee): 104002200
Entry
104002200         CDS       T01005                                 

Definition
(RefSeq) immunoglobulin heavy variable 6-1
  KO
K06856  immunoglobulin heavy chain
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04020  Calcium signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04145  Phagosome
ptr04151  PI3K-Akt signaling pathway
ptr04613  Neutrophil extracellular trap formation
ptr04640  Hematopoietic cell lineage
ptr04650  Natural killer cell mediated cytotoxicity
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04672  Intestinal immune network for IgA production
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05143  African trypanosomiasis
ptr05146  Amoebiasis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05169  Epstein-Barr virus infection
ptr05171  Coronavirus disease - COVID-19
ptr05202  Transcriptional misregulation in cancer
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05340  Primary immunodeficiency
ptr05414  Dilated cardiomyopathy
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    104002200
   04020 Calcium signaling pathway
    104002200
   04072 Phospholipase D signaling pathway
    104002200
   04151 PI3K-Akt signaling pathway
    104002200
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104002200
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104002200
   04613 Neutrophil extracellular trap formation
    104002200
   04650 Natural killer cell mediated cytotoxicity
    104002200
   04662 B cell receptor signaling pathway
    104002200
   04664 Fc epsilon RI signaling pathway
    104002200
   04666 Fc gamma R-mediated phagocytosis
    104002200
   04672 Intestinal immune network for IgA production
    104002200
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    104002200
  09163 Immune disease
   05310 Asthma
    104002200
   05322 Systemic lupus erythematosus
    104002200
   05323 Rheumatoid arthritis
    104002200
   05320 Autoimmune thyroid disease
    104002200
   05330 Allograft rejection
    104002200
   05340 Primary immunodeficiency
    104002200
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104002200
   05416 Viral myocarditis
    104002200
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104002200
   05150 Staphylococcus aureus infection
    104002200
   05152 Tuberculosis
    104002200
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104002200
   05169 Epstein-Barr virus infection
    104002200
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104002200
   05140 Leishmaniasis
    104002200
   05143 African trypanosomiasis
    104002200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    104002200
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    104002200
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 104002200
NCBI-ProteinID: XP_009426890
LinkDB
Position
14
AA seq 161 aa
MSVSFLIFLPVLGLPWGVLSQVQLQQSGPGLVKPSQTLSLTCAISRDSVSSNSAAWNWIR
QSPSRGLEWLGRTYYRSKWYNDYAASVQSRITINPDTSKNQFSLQLNSVTPEDTAVYYCA
RDTVRGSQCEPRHKPPCRDAQDPRRHPALPAQGPDQEQVWS
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtctgtctccttcctcatcttcctgcccgtgctgggcctcccatggggtgtcctgtca
caggtacagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctcactc
acctgtgccatctccagggacagtgtctctagcaacagtgctgcttggaactggatcagg
cagtccccatcgagaggccttgagtggctgggaaggacatactacaggtccaagtggtat
aatgattatgcagcatctgtgcaaagtcgaataaccatcaacccagacacatccaagaac
cagttctccctgcagctgaactctgtgactcccgaggacacggctgtgtattactgtgca
agagacacagtgaggggaagccagtgtgagcccagacacaaacctccctgcagggatgct
caggaccccagaaggcacccagcactaccagcgcagggcccagaccaggagcaggtgtgg
agttaa

KEGG   Pan troglodytes (chimpanzee): 104002202
Entry
104002202         CDS       T01005                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04020  Calcium signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04145  Phagosome
ptr04151  PI3K-Akt signaling pathway
ptr04613  Neutrophil extracellular trap formation
ptr04640  Hematopoietic cell lineage
ptr04650  Natural killer cell mediated cytotoxicity
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04672  Intestinal immune network for IgA production
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05143  African trypanosomiasis
ptr05146  Amoebiasis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
ptr05169  Epstein-Barr virus infection
ptr05171  Coronavirus disease - COVID-19
ptr05202  Transcriptional misregulation in cancer
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05340  Primary immunodeficiency
ptr05414  Dilated cardiomyopathy
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    104002202
   04020 Calcium signaling pathway
    104002202
   04072 Phospholipase D signaling pathway
    104002202
   04151 PI3K-Akt signaling pathway
    104002202
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104002202
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104002202
   04613 Neutrophil extracellular trap formation
    104002202
   04650 Natural killer cell mediated cytotoxicity
    104002202
   04662 B cell receptor signaling pathway
    104002202
   04664 Fc epsilon RI signaling pathway
    104002202
   04666 Fc gamma R-mediated phagocytosis
    104002202
   04672 Intestinal immune network for IgA production
    104002202
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    104002202
  09163 Immune disease
   05310 Asthma
    104002202
   05322 Systemic lupus erythematosus
    104002202
   05323 Rheumatoid arthritis
    104002202
   05320 Autoimmune thyroid disease
    104002202
   05330 Allograft rejection
    104002202
   05340 Primary immunodeficiency
    104002202
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104002202
   05416 Viral myocarditis
    104002202
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104002202
   05150 Staphylococcus aureus infection
    104002202
   05152 Tuberculosis
    104002202
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104002202
   05169 Epstein-Barr virus infection
    104002202
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104002202
   05140 Leishmaniasis
    104002202
   05143 African trypanosomiasis
    104002202
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    104002202
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    104002202
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Inhibitor_I68
Other DBs
NCBI-GeneID: 104002202
NCBI-ProteinID: XP_016782388
LinkDB
Position
14
AA seq 156 aa
MKHLWFFILLVAAPRWVLFQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWVRQP
PGKGLEWIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCARGTV
RGGECEPRQKPPCREAEGAGAGAAQDQQGARGAHRA
NT seq 471 nt   +upstreamnt  +downstreamnt
atgaaacacctgtggttcttcatcctgctggtggcagctcccagatgggtcctgttccag
gtgcagctgcaggagtcgggcccaggactggtgaagccttcagagaccctgtccctcacc
tgcgctgtctctggtggctccatcagcagtagtaactggtggagctgggtccgccagccc
ccagggaaggggctggagtggattggggaaatctatcatagtgggagccccaactacaac
ccgtccctcaagagtcgagtcaccatatcagtagacaagtccaagaaccagttctccctg
aagctgagctctgtgaccgccgcggacacggccgtgtattactgtgcgagaggcacggtg
aggggaggtgagtgtgagcccagacaaaaacctccctgcagggaggcggagggggcgggc
gcaggtgctgctcaggaccagcagggggcgcgcggggcccacagagcatga

DBGET integrated database retrieval system