KEGG   Pan troglodytes (chimpanzee): 100609242Help
Entry
100609242         CDS       T01005                                 

Gene name
GNG12
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 isoform X2
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04371  Apelin signaling pathway
ptr04713  Circadian entrainment
ptr04723  Retrograde endocannabinoid signaling
ptr04724  Glutamatergic synapse
ptr04725  Cholinergic synapse
ptr04726  Serotonergic synapse
ptr04727  GABAergic synapse
ptr04728  Dopaminergic synapse
ptr04810  Regulation of actin cytoskeleton
ptr04926  Relaxin signaling pathway
ptr05032  Morphine addiction
ptr05034  Alcoholism
ptr05163  Human cytomegalovirus infection
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100609242 (GNG12)
   04010 MAPK signaling pathway
    100609242 (GNG12)
   04371 Apelin signaling pathway
    100609242 (GNG12)
   04151 PI3K-Akt signaling pathway
    100609242 (GNG12)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100609242 (GNG12)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100609242 (GNG12)
  Endocrine system
   04926 Relaxin signaling pathway
    100609242 (GNG12)
  Nervous system
   04724 Glutamatergic synapse
    100609242 (GNG12)
   04727 GABAergic synapse
    100609242 (GNG12)
   04725 Cholinergic synapse
    100609242 (GNG12)
   04728 Dopaminergic synapse
    100609242 (GNG12)
   04726 Serotonergic synapse
    100609242 (GNG12)
   04723 Retrograde endocannabinoid signaling
    100609242 (GNG12)
  Environmental adaptation
   04713 Circadian entrainment
    100609242 (GNG12)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100609242 (GNG12)
  Substance dependence
   05032 Morphine addiction
    100609242 (GNG12)
   05034 Alcoholism
    100609242 (GNG12)
  Infectious diseases
   05163 Human cytomegalovirus infection
    100609242 (GNG12)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100609242 (GNG12)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100609242 (GNG12)
  Exosomal proteins of colorectal cancer cells
   100609242 (GNG12)
GTP-binding proteins [BR:ptr04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100609242 (GNG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CP12
Motif
Other DBs
NCBI-GeneID: 100609242
NCBI-ProteinID: XP_003308182
Ensembl: ENSPTRG00000000843
VGNC: 13357
UniProt: H2QZN8
LinkDB All DBs
Position
1
AA seq 72 aa AA seqDB search
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaaacagcaagcaccaacaatatagcccaggcaaggagaactgtgcagcag
ttaagattagaagcctccattgaaagaataaaggtttcgaaggcatcagcggacctcatg
tcctactgtgaggaacatgccaggagtgaccctttgctgataggaataccaacttcagaa
aaccctttcaaggataaaaaaacttgcatcatcttatag

DBGET integrated database retrieval system