KEGG   Pan troglodytes (chimpanzee): 100609537
Entry
100609537         CDS       T01005                                 

Gene name
IKBKG
Definition
(RefSeq) LOW QUALITY PROTEIN: NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01523  Antifolate resistance
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04380  Osteoclast differentiation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04668  TNF signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05212  Pancreatic cancer
ptr05215  Prostate cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05340  Primary immunodeficiency
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100609537 (IKBKG)
   04014 Ras signaling pathway
    100609537 (IKBKG)
   04064 NF-kappa B signaling pathway
    100609537 (IKBKG)
   04668 TNF signaling pathway
    100609537 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100609537 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100609537 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100609537 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100609537 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100609537 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100609537 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100609537 (IKBKG)
   04660 T cell receptor signaling pathway
    100609537 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100609537 (IKBKG)
   04659 Th17 cell differentiation
    100609537 (IKBKG)
   04657 IL-17 signaling pathway
    100609537 (IKBKG)
   04662 B cell receptor signaling pathway
    100609537 (IKBKG)
   04062 Chemokine signaling pathway
    100609537 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100609537 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100609537 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100609537 (IKBKG)
   05203 Viral carcinogenesis
    100609537 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100609537 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100609537 (IKBKG)
   05221 Acute myeloid leukemia
    100609537 (IKBKG)
   05220 Chronic myeloid leukemia
    100609537 (IKBKG)
   05215 Prostate cancer
    100609537 (IKBKG)
   05222 Small cell lung cancer
    100609537 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100609537 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100609537 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100609537 (IKBKG)
   05135 Yersinia infection
    100609537 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100609537 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100609537 (IKBKG)
   05162 Measles
    100609537 (IKBKG)
   05164 Influenza A
    100609537 (IKBKG)
   05161 Hepatitis B
    100609537 (IKBKG)
   05160 Hepatitis C
    100609537 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100609537 (IKBKG)
   05163 Human cytomegalovirus infection
    100609537 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100609537 (IKBKG)
   05169 Epstein-Barr virus infection
    100609537 (IKBKG)
   05165 Human papillomavirus infection
    100609537 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100609537 (IKBKG)
   05142 Chagas disease
    100609537 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100609537 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    100609537 (IKBKG)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100609537 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL LLC1
Other DBs
NCBI-GeneID: 100609537
NCBI-ProteinID: XP_024208923
VGNC: 14692
LinkDB
Position
X
AA seq 394 aa
MGEAPMQTPREPQAHVGPGRARQAGLPSSPPLSPLPPDAIRQSNQMLRERCEELLHFQAS
QREEKEFLMCKFQEARKLVERLSLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQ
VTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ
GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ
QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEK
KELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQR
RXPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgggtgaggctcccatgcagacacccagagagcctcaggcccatgtgggcccaggcagg
gcccggcaggccgggctgcccagctcccctccactgtcccctctgccaccagatgccatc
cggcagagcaaccagatgctgcgggagcgctgcgaggagcttctgcatttccaagccagc
cagagggaggagaaggagtttctcatgtgcaagttccaggaggccaggaaactggtggag
agactcagcctggagaagctcgacctgaagaggcagaaggagcaggctctgcgggaggtg
gagcacctgaagagatgccagcagcagatggctgaggacaaggcctctgtgaaagcccag
gtgacgtccttgctcggggagctgcaggagagccagagtcgcttggaggctgccactaag
gaatgccaggctctggagggtcgggcccgggcggccagcgagcaggcgcggcagctggag
agtgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggaccagctgcgcatgcag
ggccagagcgtggaggccgcgctccgcatggagcgccaggccgcctcggaggagaagagg
aagctggcccagttgcaggtggcctatcaccagctcttccaagaatacgacaaccacatc
aagagcagcgtggtgggcagtgagcggaagcgaggaatgcagctggaagatctcaaacag
cagctccagcaggccgaggaggccctggtggccaaacaggaggtgatcgataagctgaag
gaggaggccgagcagcacaagattgtgatggagaccgttccggtgctgaaggcccaggcg
gatatctacaaggcggacttccaggctgagaggcaggcccgggagaagctggctgagaag
aaggagctcctgcaggagcagctggagcagctgcagagggagtacagcaaactgaaggcc
agctgtcaggagtcggccaggatcgaggacatgaggaagcggcatgtcgaggtctcccag
gcccccttgccccccgcccctgcctacctctcctctcccctggccctgcccagccagagg
aggnagccccccgaggagccacctgacttctgctgtcccaagtgccagtatcaggcccct
gatatggacaccctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system