KEGG   Pan troglodytes (chimpanzee): 100609537
Entry
100609537         CDS       T01005                                 

Gene name
IKBKG
Definition
(RefSeq) LOW QUALITY PROTEIN: NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01523  Antifolate resistance
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04380  Osteoclast differentiation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04668  TNF signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05212  Pancreatic cancer
ptr05215  Prostate cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05340  Primary immunodeficiency
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100609537 (IKBKG)
   04014 Ras signaling pathway
    100609537 (IKBKG)
   04064 NF-kappa B signaling pathway
    100609537 (IKBKG)
   04668 TNF signaling pathway
    100609537 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100609537 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100609537 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100609537 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100609537 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100609537 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100609537 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100609537 (IKBKG)
   04660 T cell receptor signaling pathway
    100609537 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100609537 (IKBKG)
   04659 Th17 cell differentiation
    100609537 (IKBKG)
   04657 IL-17 signaling pathway
    100609537 (IKBKG)
   04662 B cell receptor signaling pathway
    100609537 (IKBKG)
   04062 Chemokine signaling pathway
    100609537 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100609537 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100609537 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100609537 (IKBKG)
   05203 Viral carcinogenesis
    100609537 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100609537 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100609537 (IKBKG)
   05221 Acute myeloid leukemia
    100609537 (IKBKG)
   05220 Chronic myeloid leukemia
    100609537 (IKBKG)
   05215 Prostate cancer
    100609537 (IKBKG)
   05222 Small cell lung cancer
    100609537 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100609537 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100609537 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100609537 (IKBKG)
   05135 Yersinia infection
    100609537 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100609537 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100609537 (IKBKG)
   05161 Hepatitis B
    100609537 (IKBKG)
   05160 Hepatitis C
    100609537 (IKBKG)
   05171 Coronavirus disease - COVID-19
    100609537 (IKBKG)
   05164 Influenza A
    100609537 (IKBKG)
   05162 Measles
    100609537 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100609537 (IKBKG)
   05163 Human cytomegalovirus infection
    100609537 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100609537 (IKBKG)
   05169 Epstein-Barr virus infection
    100609537 (IKBKG)
   05165 Human papillomavirus infection
    100609537 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100609537 (IKBKG)
   05142 Chagas disease
    100609537 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100609537 (IKBKG)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100609537 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL LLC1
Other DBs
NCBI-GeneID: 100609537
NCBI-ProteinID: XP_024208923
VGNC: 14692
LinkDB
Position
X
AA seq 394 aa
MGEAPMQTPREPQAHVGPGRARQAGLPSSPPLSPLPPDAIRQSNQMLRERCEELLHFQAS
QREEKEFLMCKFQEARKLVERLSLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQ
VTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ
GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ
QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEK
KELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQR
RXPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgggtgaggctcccatgcagacacccagagagcctcaggcccatgtgggcccaggcagg
gcccggcaggccgggctgcccagctcccctccactgtcccctctgccaccagatgccatc
cggcagagcaaccagatgctgcgggagcgctgcgaggagcttctgcatttccaagccagc
cagagggaggagaaggagtttctcatgtgcaagttccaggaggccaggaaactggtggag
agactcagcctggagaagctcgacctgaagaggcagaaggagcaggctctgcgggaggtg
gagcacctgaagagatgccagcagcagatggctgaggacaaggcctctgtgaaagcccag
gtgacgtccttgctcggggagctgcaggagagccagagtcgcttggaggctgccactaag
gaatgccaggctctggagggtcgggcccgggcggccagcgagcaggcgcggcagctggag
agtgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggaccagctgcgcatgcag
ggccagagcgtggaggccgcgctccgcatggagcgccaggccgcctcggaggagaagagg
aagctggcccagttgcaggtggcctatcaccagctcttccaagaatacgacaaccacatc
aagagcagcgtggtgggcagtgagcggaagcgaggaatgcagctggaagatctcaaacag
cagctccagcaggccgaggaggccctggtggccaaacaggaggtgatcgataagctgaag
gaggaggccgagcagcacaagattgtgatggagaccgttccggtgctgaaggcccaggcg
gatatctacaaggcggacttccaggctgagaggcaggcccgggagaagctggctgagaag
aaggagctcctgcaggagcagctggagcagctgcagagggagtacagcaaactgaaggcc
agctgtcaggagtcggccaggatcgaggacatgaggaagcggcatgtcgaggtctcccag
gcccccttgccccccgcccctgcctacctctcctctcccctggccctgcccagccagagg
aggnagccccccgaggagccacctgacttctgctgtcccaagtgccagtatcaggcccct
gatatggacaccctgcagatacatgtcatggagtgcattgagtag

KEGG   Pan troglodytes (chimpanzee): 100610002
Entry
100610002         CDS       T01005                                 

Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01523  Antifolate resistance
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04380  Osteoclast differentiation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04668  TNF signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05212  Pancreatic cancer
ptr05215  Prostate cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05340  Primary immunodeficiency
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100610002
   04014 Ras signaling pathway
    100610002
   04064 NF-kappa B signaling pathway
    100610002
   04668 TNF signaling pathway
    100610002
   04151 PI3K-Akt signaling pathway
    100610002
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100610002
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100610002
   04621 NOD-like receptor signaling pathway
    100610002
   04622 RIG-I-like receptor signaling pathway
    100610002
   04623 Cytosolic DNA-sensing pathway
    100610002
   04625 C-type lectin receptor signaling pathway
    100610002
   04660 T cell receptor signaling pathway
    100610002
   04658 Th1 and Th2 cell differentiation
    100610002
   04659 Th17 cell differentiation
    100610002
   04657 IL-17 signaling pathway
    100610002
   04662 B cell receptor signaling pathway
    100610002
   04062 Chemokine signaling pathway
    100610002
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100610002
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100610002
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100610002
   05203 Viral carcinogenesis
    100610002
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100610002
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100610002
   05221 Acute myeloid leukemia
    100610002
   05220 Chronic myeloid leukemia
    100610002
   05215 Prostate cancer
    100610002
   05222 Small cell lung cancer
    100610002
  09163 Immune disease
   05340 Primary immunodeficiency
    100610002
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100610002
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100610002
   05135 Yersinia infection
    100610002
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100610002
   05170 Human immunodeficiency virus 1 infection
    100610002
   05161 Hepatitis B
    100610002
   05160 Hepatitis C
    100610002
   05171 Coronavirus disease - COVID-19
    100610002
   05164 Influenza A
    100610002
   05162 Measles
    100610002
   05168 Herpes simplex virus 1 infection
    100610002
   05163 Human cytomegalovirus infection
    100610002
   05167 Kaposi sarcoma-associated herpesvirus infection
    100610002
   05169 Epstein-Barr virus infection
    100610002
   05165 Human papillomavirus infection
    100610002
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100610002
   05142 Chagas disease
    100610002
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100610002
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100610002
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL LLC1
Other DBs
NCBI-GeneID: 100610002
NCBI-ProteinID: XP_016800099
LinkDB
Position
X
AA seq 453 aa
MEAERTLRPGELPGIQGRSELALFQPEVRKGKLKDQQQCAEPPAPAANITGTKAEAQGAK
MKIQEHSNCQPQAHVGPGRARQAGLPSSPPLSPLPPDAIRQSNQMLRERCEELLHFQASQ
REEKEFLMCKFQEARKLVERLSLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQV
TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQG
QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ
LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKK
ELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRR
SPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggaagctgagaggacgctgagacctggggagcttcctggaattcagggacgcagtgaa
ctcgctctgtttcagcccgaggtgcgcaaaggaaaactgaaagaccagcagcaatgtgct
gagccaccggcccctgcagccaacatcacgggcacaaaagcagaagcccagggagcaaag
atgaagatccaggagcacagtaactgtcagcctcaggcccatgtgggcccaggcagggcc
cggcaggccgggctgcccagctcccctccactgtcccctctgccaccagatgccatccgg
cagagcaaccagatgctgcgggagcgctgcgaggagcttctgcatttccaagccagccag
agggaggagaaggagtttctcatgtgcaagttccaggaggccaggaaactggtggagaga
ctcagcctggagaagctcgacctgaagaggcagaaggagcaggctctgcgggaggtggag
cacctgaagagatgccagcagcagatggctgaggacaaggcctctgtgaaagcccaggtg
acgtccttgctcggggagctgcaggagagccagagtcgcttggaggctgccactaaggaa
tgccaggctctggagggtcgggcccgggcggccagcgagcaggcgcggcagctggagagt
gagcgcgaggcgctgcagcagcagcacagcgtgcaggtggaccagctgcgcatgcagggc
cagagcgtggaggccgcgctccgcatggagcgccaggccgcctcggaggagaagaggaag
ctggcccagttgcaggtggcctatcaccagctcttccaagaatacgacaaccacatcaag
agcagcgtggtgggcagtgagcggaagcgaggaatgcagctggaagatctcaaacagcag
ctccagcaggccgaggaggccctggtggccaaacaggaggtgatcgataagctgaaggag
gaggccgagcagcacaagattgtgatggagaccgttccggtgctgaaggcccaggcggat
atctacaaggcggacttccaggctgagaggcaggcccgggagaagctggctgagaagaag
gagctcctgcaggagcagctggagcagctgcagagggagtacagcaaactgaaggccagc
tgtcaggagtcggccaggatcgaggacatgaggaagcggcatgtcgaggtctcccaggcc
cccttgccccccgcccctgcctacctctcctctcccctggccctgcccagccagaggagg
agcccccccgaggagccacctgacttctgctgtcccaagtgccagtatcaggcccctgat
atggacaccctgcagatacatgtcatggagtgcattgagtag

KEGG   Pan troglodytes (chimpanzee): 450673
Entry
450673            CDS       T01005                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01523  Antifolate resistance
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04068  FoxO signaling pathway
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04380  Osteoclast differentiation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04668  TNF signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr05010  Alzheimer disease
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05212  Pancreatic cancer
ptr05215  Prostate cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    450673 (CHUK)
   04014 Ras signaling pathway
    450673 (CHUK)
   04064 NF-kappa B signaling pathway
    450673 (CHUK)
   04668 TNF signaling pathway
    450673 (CHUK)
   04068 FoxO signaling pathway
    450673 (CHUK)
   04151 PI3K-Akt signaling pathway
    450673 (CHUK)
   04150 mTOR signaling pathway
    450673 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    450673 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    450673 (CHUK)
   04621 NOD-like receptor signaling pathway
    450673 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    450673 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    450673 (CHUK)
   04625 C-type lectin receptor signaling pathway
    450673 (CHUK)
   04660 T cell receptor signaling pathway
    450673 (CHUK)
   04658 Th1 and Th2 cell differentiation
    450673 (CHUK)
   04659 Th17 cell differentiation
    450673 (CHUK)
   04657 IL-17 signaling pathway
    450673 (CHUK)
   04662 B cell receptor signaling pathway
    450673 (CHUK)
   04062 Chemokine signaling pathway
    450673 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    450673 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    450673 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    450673 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    450673 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    450673 (CHUK)
   05221 Acute myeloid leukemia
    450673 (CHUK)
   05220 Chronic myeloid leukemia
    450673 (CHUK)
   05215 Prostate cancer
    450673 (CHUK)
   05222 Small cell lung cancer
    450673 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    450673 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    450673 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    450673 (CHUK)
   05135 Yersinia infection
    450673 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    450673 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    450673 (CHUK)
   05161 Hepatitis B
    450673 (CHUK)
   05160 Hepatitis C
    450673 (CHUK)
   05171 Coronavirus disease - COVID-19
    450673 (CHUK)
   05164 Influenza A
    450673 (CHUK)
   05162 Measles
    450673 (CHUK)
   05168 Herpes simplex virus 1 infection
    450673 (CHUK)
   05163 Human cytomegalovirus infection
    450673 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    450673 (CHUK)
   05169 Epstein-Barr virus infection
    450673 (CHUK)
   05165 Human papillomavirus infection
    450673 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    450673 (CHUK)
   05142 Chagas disease
    450673 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    450673 (CHUK)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     450673 (CHUK)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   450673 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 450673
NCBI-ProteinID: NP_001267150
Ensembl: ENSPTRG00000033948
VGNC: 1627
UniProt: G2HEU2
LinkDB
Position
10
AA seq 724 aa
MDGLWNWGCIPGRDSMRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNHANVVKACD
VPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHEN
KIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPY
TATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMSGEVRFSSHL
PQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDFTLKQPRCFVLMDHILNLKIVHILNM
TSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRG
CDSYMVYLFDKSKTVYEGPFASRSLSGCVNYIVQDSKIQLPIIQLRKVWAEAVHYVSGLK
EDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLDLERYSEQM
TYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLME
SLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKI
IDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQ
TSAWLPPTSAEHDHSLSCVVTPQDGLRCAVSKASGSLLACVLSLFSQLMETSTAPAFPGS
SAHN
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggacgggctttggaattggggatgtattccaggtcgggacagtatgagggaacttgat
ctcaaaatagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacgatgg
tgccatgaaatccagattatgaagaagttgaatcatgccaatgttgtaaaggcctgtgat
gttcctgaagaattgaatattttgattcatgatgtgcctcttctagcaatggaatactgt
tctggaggagatctccgaaagctgctcaacaaaccagaaaattgttgtggacttaaagaa
agccagatactttctttactaagtgatatagggtctgggattcgatatttgcatgaaaac
aaaattatacatcgagatctaaaacctgaaaacatagttcttcaggatgttggtggaaag
ataatacataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgt
acatcttttgtgggaacactgcagtatctggccccagagctctttgagaataagccttac
acagccactgttgattattggagctttgggaccatggtatttgaatgtattgctggatat
aggccttttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggat
ccaaagtgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccattta
cctcaaccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttg
atgttgaattgggaccctcagcagagaggaggacctgttgactttactttgaagcagcca
agatgtttcgtattaatggatcacattttgaatttgaagatagtacacatcctaaatatg
acttctgcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacag
tctcgtattgagcgtgaaactggaataaatactggttctcaagaacttctttcagagaca
ggaatttctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggc
tgtgatagctatatggtttatttgtttgataaaagtaaaactgtatatgaagggccattt
gcttccagaagcttatctggttgtgtaaattatattgtacaggacagcaaaatacagctt
ccaattatacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctggactaaaa
gaagactatagcaggctctttcagggacaaagggcagcaatgttaagtcttcttagatat
aatgctaacttaacaaaaatgaagaacactttgatctcagcatcacaacaactgaaagct
aaattggagttttttcacaaaagcattcagcttgacttggagagatacagcgagcagatg
acgtatgggatatcttcagaaaaaatgctaaaagcatggaaagaaatggaagaaaaggcc
atccactatgctgaggttggtgtcattggatatctggaggatcagattatgtctttgcat
gctgaaatcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaa
tctctggaacagcgtgccattgatctatataagcagttaaaacacagaccttcagatcac
tcctacagtgacagcacagagatggtgaaaatcattgtgcacactgtgcagagtcaggac
cgtgtgctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagatt
attgatctactccctaaggtggaagtggccctcagtaatatcaaagaagctgacaatact
gtcatgttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgt
acacagagttctgcccggtcccttgtaggatccagtctagaaggtgcagtaacccctcag
acatcagcatggctgcccccgacttcagcagaacatgatcattctctgtcatgtgtggta
actcctcaagatggcttaagatgtgccgtatccaaagccagtggctctttgctagcttgt
gtattgtcgcttttctcacaactcatggagacctctacagcaccagcatttcctggaagc
tctgcccataattag

KEGG   Pan troglodytes (chimpanzee): 472749
Entry
472749            CDS       T01005                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X1
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01523  Antifolate resistance
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04068  FoxO signaling pathway
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04380  Osteoclast differentiation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04910  Insulin signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr05010  Alzheimer disease
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05206  MicroRNAs in cancer
ptr05212  Pancreatic cancer
ptr05215  Prostate cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    472749 (IKBKB)
   04014 Ras signaling pathway
    472749 (IKBKB)
   04064 NF-kappa B signaling pathway
    472749 (IKBKB)
   04668 TNF signaling pathway
    472749 (IKBKB)
   04068 FoxO signaling pathway
    472749 (IKBKB)
   04151 PI3K-Akt signaling pathway
    472749 (IKBKB)
   04150 mTOR signaling pathway
    472749 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    472749 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    472749 (IKBKB)
   04621 NOD-like receptor signaling pathway
    472749 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    472749 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    472749 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    472749 (IKBKB)
   04660 T cell receptor signaling pathway
    472749 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    472749 (IKBKB)
   04659 Th17 cell differentiation
    472749 (IKBKB)
   04657 IL-17 signaling pathway
    472749 (IKBKB)
   04662 B cell receptor signaling pathway
    472749 (IKBKB)
   04062 Chemokine signaling pathway
    472749 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    472749 (IKBKB)
   04920 Adipocytokine signaling pathway
    472749 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    472749 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    472749 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    472749 (IKBKB)
   05206 MicroRNAs in cancer
    472749 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    472749 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    472749 (IKBKB)
   05221 Acute myeloid leukemia
    472749 (IKBKB)
   05220 Chronic myeloid leukemia
    472749 (IKBKB)
   05215 Prostate cancer
    472749 (IKBKB)
   05222 Small cell lung cancer
    472749 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    472749 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    472749 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    472749 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    472749 (IKBKB)
   04931 Insulin resistance
    472749 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    472749 (IKBKB)
   05135 Yersinia infection
    472749 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    472749 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    472749 (IKBKB)
   05161 Hepatitis B
    472749 (IKBKB)
   05160 Hepatitis C
    472749 (IKBKB)
   05171 Coronavirus disease - COVID-19
    472749 (IKBKB)
   05164 Influenza A
    472749 (IKBKB)
   05162 Measles
    472749 (IKBKB)
   05168 Herpes simplex virus 1 infection
    472749 (IKBKB)
   05163 Human cytomegalovirus infection
    472749 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    472749 (IKBKB)
   05169 Epstein-Barr virus infection
    472749 (IKBKB)
   05165 Human papillomavirus infection
    472749 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    472749 (IKBKB)
   05142 Chagas disease
    472749 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    472749 (IKBKB)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     472749 (IKBKB)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   472749 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal IKKbetaNEMObind Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m
Other DBs
NCBI-GeneID: 472749
NCBI-ProteinID: XP_016814900
Ensembl: ENSPTRG00000020202
VGNC: 14635
LinkDB
Position
8
AA seq 805 aa
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVICKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLE
NAIQDTVREQDQSFTVTACVSLLRFHVLSFYGKIEEKMEMQSGIILNLSVCLFACLFVTG
SLSLIQAGVQWHDLGSLQPPLPGFK
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgacaacgcagacatgtggggcctgggaaatgaaagagcgc
cttgggacagggggatttggaaatgtcatccgatggcacaatcaggaaacaggtgagcag
attgccatcaagcagtgccggcaggagctcagcccccggaaccgagagcggtggtgcctg
gagatccagatcatgagaaggctgacccaccccaatgtggtggctgcccgagatgtccct
gaggggatgcagaacttggcgcccaatgacctgcccctgctggccatggagtactgccaa
ggaggagatctccggaagtacctgaaccagtttgagaactgctgtggtctgcgggaaggt
gccatcctcaccttgctgagtgacattgcctctgcgcttagataccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagaacagaggtta
atacacaaaattattgacctaggatatgccaaggagctggatcagggcagtctttgcaca
tcattcgtggggaccctgcagtacctggccccagagctactggagcagcagaagtacaca
gtgaccgtcgactactggagcttcggcaccctggcctttgagtgcatcacgggcttccgg
cccttcctccccaactggcagcctgtgcagtggcattcgaaagtgcggcagaagagtgag
gtggacattgttgttagcgaagacttgaatggaacggtgaagttttcaagctctttaccc
taccccaataatcttaacagtgtcctggctgagcgactggagaagtggctgcaactgatg
ctgatgtggcacccccgacagaggggcacggatcccacgtatgggcccaacggctgcttc
aaggccctggatgacatcttaaacttaaagctggttcatatcttgaacatggtcacgggc
accatccacacctaccctgtgacagaggatgagagtctgcagagcttgaaggccagaatc
cagcaggacacgggcatcccagaggaggaccaggagctgctgcaggaagcgggcctggcg
ttgatccccgataagcctgccactcagtgtatttcagacggcaagttaaatgagggccac
acattggacatggatcttgtttttctctttgacaacagtaaaatcacctatgagactcag
atctccccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaat
ctcgccttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagaccctg
aaggaagattgcaaccggctgcagcagggacagcgagccgccatgatgaatctcctccga
aacaacagctgcctctccaaaatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttggatttcttcaaaaccagcatccagattgacctggagaagtacagtgagcaa
accgagtttgggatcacatcagataaactgctgctggcctggagggaaatggagcaggct
gtggagctctgtgggcgggagaacgaagtgaaactcctggtagaacggatgatggctctg
cagaccgacattgtggacttacagaggagccccatgggccggaagcaggggggaacgctg
gacgacctagaggagcaagcaagggagctgtacaggagactaagggaaaaacctcgagac
cagcgaactgagggtgacagtcaggaaatggtacggctgctgcttcaggcaattcagagc
ttcgagaagaaagtgcgagtgatctatacgcagctcagtaaaactgtgatttgcaagcag
aaggcgctggaactgttgcccaaggtggaagaggtggtgagcttaatgaatgaggatgag
aagactgttgtccggctgcaggagaagcggcagaaggagctctggaatctcctgaagatt
gcttgtagcaaggtccgtggtcctgtcagtggaagtccggatagcatgaatgcctctcga
cttagccagcctgggcagctgatgtctcagccctccacggcctccaacagcttacctgag
ccagccaaaaagagtgaagaactggtggctgaagcacataacctgtgcaccctgctagaa
aatgccatacaggacaccgtgagggaacaagaccagagtttcacggtaacagcttgtgtg
agcctcctgcgattccatgtcctttctttctatggcaaaatagaagagaaaatggaaatg
caatctggcattatcctcaacctcagtgtttgtttgtttgcttgtttatttgtgacaggg
tctctctctctcatccaggctggagtgcagtggcatgatcttggctcactgcaacctccg
cttcccgggttcaagtga

DBGET integrated database retrieval system