KEGG   Pan troglodytes (chimpanzee): 100609583
Entry
100609583         CDS       T01005                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04370  VEGF signaling pathway
ptr04371  Apelin signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04728  Dopaminergic synapse
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04922  Glucagon signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04973  Carbohydrate digestion and absorption
ptr05010  Alzheimer disease
ptr05017  Spinocerebellar ataxia
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100609583 (AKT3)
   04012 ErbB signaling pathway
    100609583 (AKT3)
   04014 Ras signaling pathway
    100609583 (AKT3)
   04015 Rap1 signaling pathway
    100609583 (AKT3)
   04370 VEGF signaling pathway
    100609583 (AKT3)
   04371 Apelin signaling pathway
    100609583 (AKT3)
   04630 JAK-STAT signaling pathway
    100609583 (AKT3)
   04668 TNF signaling pathway
    100609583 (AKT3)
   04066 HIF-1 signaling pathway
    100609583 (AKT3)
   04068 FoxO signaling pathway
    100609583 (AKT3)
   04072 Phospholipase D signaling pathway
    100609583 (AKT3)
   04071 Sphingolipid signaling pathway
    100609583 (AKT3)
   04024 cAMP signaling pathway
    100609583 (AKT3)
   04022 cGMP-PKG signaling pathway
    100609583 (AKT3)
   04151 PI3K-Akt signaling pathway
    100609583 (AKT3)
   04152 AMPK signaling pathway
    100609583 (AKT3)
   04150 mTOR signaling pathway
    100609583 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100609583 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100609583 (AKT3)
   04218 Cellular senescence
    100609583 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100609583 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100609583 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100609583 (AKT3)
   04613 Neutrophil extracellular trap formation
    100609583 (AKT3)
   04620 Toll-like receptor signaling pathway
    100609583 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100609583 (AKT3)
   04660 T cell receptor signaling pathway
    100609583 (AKT3)
   04662 B cell receptor signaling pathway
    100609583 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100609583 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100609583 (AKT3)
   04062 Chemokine signaling pathway
    100609583 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100609583 (AKT3)
   04922 Glucagon signaling pathway
    100609583 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100609583 (AKT3)
   04920 Adipocytokine signaling pathway
    100609583 (AKT3)
   04929 GnRH secretion
    100609583 (AKT3)
   04915 Estrogen signaling pathway
    100609583 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100609583 (AKT3)
   04917 Prolactin signaling pathway
    100609583 (AKT3)
   04926 Relaxin signaling pathway
    100609583 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100609583 (AKT3)
   04919 Thyroid hormone signaling pathway
    100609583 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100609583 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100609583 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100609583 (AKT3)
   04728 Dopaminergic synapse
    100609583 (AKT3)
   04722 Neurotrophin signaling pathway
    100609583 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100609583 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100609583 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100609583 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100609583 (AKT3)
   05205 Proteoglycans in cancer
    100609583 (AKT3)
   05230 Central carbon metabolism in cancer
    100609583 (AKT3)
   05231 Choline metabolism in cancer
    100609583 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100609583 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100609583 (AKT3)
   05212 Pancreatic cancer
    100609583 (AKT3)
   05225 Hepatocellular carcinoma
    100609583 (AKT3)
   05226 Gastric cancer
    100609583 (AKT3)
   05214 Glioma
    100609583 (AKT3)
   05221 Acute myeloid leukemia
    100609583 (AKT3)
   05220 Chronic myeloid leukemia
    100609583 (AKT3)
   05218 Melanoma
    100609583 (AKT3)
   05211 Renal cell carcinoma
    100609583 (AKT3)
   05215 Prostate cancer
    100609583 (AKT3)
   05213 Endometrial cancer
    100609583 (AKT3)
   05224 Breast cancer
    100609583 (AKT3)
   05222 Small cell lung cancer
    100609583 (AKT3)
   05223 Non-small cell lung cancer
    100609583 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100609583 (AKT3)
   05017 Spinocerebellar ataxia
    100609583 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100609583 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100609583 (AKT3)
   04931 Insulin resistance
    100609583 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100609583 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100609583 (AKT3)
   05135 Yersinia infection
    100609583 (AKT3)
   05152 Tuberculosis
    100609583 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100609583 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100609583 (AKT3)
   05161 Hepatitis B
    100609583 (AKT3)
   05160 Hepatitis C
    100609583 (AKT3)
   05164 Influenza A
    100609583 (AKT3)
   05162 Measles
    100609583 (AKT3)
   05168 Herpes simplex virus 1 infection
    100609583 (AKT3)
   05163 Human cytomegalovirus infection
    100609583 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100609583 (AKT3)
   05169 Epstein-Barr virus infection
    100609583 (AKT3)
   05165 Human papillomavirus infection
    100609583 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100609583 (AKT3)
   05142 Chagas disease
    100609583 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100609583 (AKT3)
   01524 Platinum drug resistance
    100609583 (AKT3)
   01522 Endocrine resistance
    100609583 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    100609583 (AKT3)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100609583 (AKT3)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100609583 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 100609583
NCBI-ProteinID: NP_001266993
Ensembl: ENSPTRG00000002174
VGNC: 11733
UniProt: G2HGV7
LinkDB
Position
1
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGQVILVREKASEKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccaa
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcctctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
caagttattttggttcgagagaaggcaagtgaaaaatattatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatctaatgctggac
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggcactccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttctctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcaattttcctactctgcaagtggacgagaataa

KEGG   Pan troglodytes (chimpanzee): 456035
Entry
456035            CDS       T01005                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X4
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04370  VEGF signaling pathway
ptr04371  Apelin signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04728  Dopaminergic synapse
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04922  Glucagon signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04973  Carbohydrate digestion and absorption
ptr05010  Alzheimer disease
ptr05017  Spinocerebellar ataxia
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    456035 (AKT2)
   04012 ErbB signaling pathway
    456035 (AKT2)
   04014 Ras signaling pathway
    456035 (AKT2)
   04015 Rap1 signaling pathway
    456035 (AKT2)
   04370 VEGF signaling pathway
    456035 (AKT2)
   04371 Apelin signaling pathway
    456035 (AKT2)
   04630 JAK-STAT signaling pathway
    456035 (AKT2)
   04668 TNF signaling pathway
    456035 (AKT2)
   04066 HIF-1 signaling pathway
    456035 (AKT2)
   04068 FoxO signaling pathway
    456035 (AKT2)
   04072 Phospholipase D signaling pathway
    456035 (AKT2)
   04071 Sphingolipid signaling pathway
    456035 (AKT2)
   04024 cAMP signaling pathway
    456035 (AKT2)
   04022 cGMP-PKG signaling pathway
    456035 (AKT2)
   04151 PI3K-Akt signaling pathway
    456035 (AKT2)
   04152 AMPK signaling pathway
    456035 (AKT2)
   04150 mTOR signaling pathway
    456035 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    456035 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    456035 (AKT2)
   04218 Cellular senescence
    456035 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    456035 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    456035 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    456035 (AKT2)
   04613 Neutrophil extracellular trap formation
    456035 (AKT2)
   04620 Toll-like receptor signaling pathway
    456035 (AKT2)
   04625 C-type lectin receptor signaling pathway
    456035 (AKT2)
   04660 T cell receptor signaling pathway
    456035 (AKT2)
   04662 B cell receptor signaling pathway
    456035 (AKT2)
   04664 Fc epsilon RI signaling pathway
    456035 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    456035 (AKT2)
   04062 Chemokine signaling pathway
    456035 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    456035 (AKT2)
   04922 Glucagon signaling pathway
    456035 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    456035 (AKT2)
   04920 Adipocytokine signaling pathway
    456035 (AKT2)
   04929 GnRH secretion
    456035 (AKT2)
   04915 Estrogen signaling pathway
    456035 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    456035 (AKT2)
   04917 Prolactin signaling pathway
    456035 (AKT2)
   04926 Relaxin signaling pathway
    456035 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    456035 (AKT2)
   04919 Thyroid hormone signaling pathway
    456035 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    456035 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    456035 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    456035 (AKT2)
   04728 Dopaminergic synapse
    456035 (AKT2)
   04722 Neurotrophin signaling pathway
    456035 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    456035 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    456035 (AKT2)
   04213 Longevity regulating pathway - multiple species
    456035 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    456035 (AKT2)
   05205 Proteoglycans in cancer
    456035 (AKT2)
   05230 Central carbon metabolism in cancer
    456035 (AKT2)
   05231 Choline metabolism in cancer
    456035 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    456035 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    456035 (AKT2)
   05212 Pancreatic cancer
    456035 (AKT2)
   05225 Hepatocellular carcinoma
    456035 (AKT2)
   05226 Gastric cancer
    456035 (AKT2)
   05214 Glioma
    456035 (AKT2)
   05221 Acute myeloid leukemia
    456035 (AKT2)
   05220 Chronic myeloid leukemia
    456035 (AKT2)
   05218 Melanoma
    456035 (AKT2)
   05211 Renal cell carcinoma
    456035 (AKT2)
   05215 Prostate cancer
    456035 (AKT2)
   05213 Endometrial cancer
    456035 (AKT2)
   05224 Breast cancer
    456035 (AKT2)
   05222 Small cell lung cancer
    456035 (AKT2)
   05223 Non-small cell lung cancer
    456035 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    456035 (AKT2)
   05017 Spinocerebellar ataxia
    456035 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    456035 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    456035 (AKT2)
   04931 Insulin resistance
    456035 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    456035 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    456035 (AKT2)
   05135 Yersinia infection
    456035 (AKT2)
   05152 Tuberculosis
    456035 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    456035 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    456035 (AKT2)
   05161 Hepatitis B
    456035 (AKT2)
   05160 Hepatitis C
    456035 (AKT2)
   05164 Influenza A
    456035 (AKT2)
   05162 Measles
    456035 (AKT2)
   05168 Herpes simplex virus 1 infection
    456035 (AKT2)
   05163 Human cytomegalovirus infection
    456035 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    456035 (AKT2)
   05169 Epstein-Barr virus infection
    456035 (AKT2)
   05165 Human papillomavirus infection
    456035 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    456035 (AKT2)
   05142 Chagas disease
    456035 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    456035 (AKT2)
   01524 Platinum drug resistance
    456035 (AKT2)
   01522 Endocrine resistance
    456035 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    456035 (AKT2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     456035 (AKT2)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   456035 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 456035
NCBI-ProteinID: XP_016791454
VGNC: 10908
LinkDB
Position
19
AA seq 523 aa
MSEVPAGVSSAQPSCWRSSFADVVSKDCALSTVPPACPAALSCPELGDSVPRCHHERGEY
IKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCL
QWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTAEEMEV
AVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTV
TESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAE
IVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLA
PEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAK
SLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRY
FDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgtcagaggtcccagcaggagtttcttcagcccagccgtcctgctggagaagctcgttc
gcagatgttgtttctaaggactgtgccctgtccacggtgcctcctgcatgtcctgctgcc
ctgagctgtcccgagctaggtgacagcgtaccacgctgccaccatgaacgaggtgaatac
atcaagacctggaggccacggtacttcctgctgaagagcgacggctccttcattgggtac
aaggagaggcccgaggcccctgatcagactctaccccccttaaacaacttctccgtagca
gaatgccagctgatgaagactgagaggccgcgacccaacacctttgtcatacgctgcctg
cagtggaccacagtcatcgagaggaccttccacgtggattctccagatgagagggaggaa
tggatgcgggccatccagatggtcgccaacagcctcaagcagcgggccccaggcgaggac
cccatggactacaagtgtggctcccccagtgactcctctacggctgaggagatggaagtg
gcggtcagcaaagcacgggctaaagtgaccatgaatgacttcgactatctcaaactcctt
ggcaagggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactac
gccatgaagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacagtc
accgagagccgagtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgcc
ttccagacccacgaccgcctgtgctttgtgatggagtatgccaacgggggtgagctgttc
ttccacctgtcccgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagag
attgtctcggctcttgagtacttgcactcacgggacgtggtataccgcgacatcaagctg
gaaaacctcatgctggacaaagatggccacatcaagatcactgactttggcctctgcaaa
gagggcatcagtgacggggccaccatgaaaaccttctgtgggaccccggagtacctggcg
cctgaggtgctggaggacaatgactatggccgggccgtggactggtgggggctgggtgtg
gtcatgtacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctc
ttcgagctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaag
tccctgcttgctgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagc
gatgccaaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtc
cagaagaagctcctgccacccttcaaacctcaggtcacgtccgaggtcgacacaaggtac
ttcgatgatgaatttaccgcccagtccatcacaatcacaccccctgaccgctatgacagc
ctgggcttactggagctggaccagcggacccacttcccccagttctcctactcggccagc
atccgcgagtga

KEGG   Pan troglodytes (chimpanzee): 740898
Entry
740898            CDS       T01005                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04370  VEGF signaling pathway
ptr04371  Apelin signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04728  Dopaminergic synapse
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04922  Glucagon signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04973  Carbohydrate digestion and absorption
ptr05010  Alzheimer disease
ptr05017  Spinocerebellar ataxia
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    740898 (AKT1)
   04012 ErbB signaling pathway
    740898 (AKT1)
   04014 Ras signaling pathway
    740898 (AKT1)
   04015 Rap1 signaling pathway
    740898 (AKT1)
   04370 VEGF signaling pathway
    740898 (AKT1)
   04371 Apelin signaling pathway
    740898 (AKT1)
   04630 JAK-STAT signaling pathway
    740898 (AKT1)
   04668 TNF signaling pathway
    740898 (AKT1)
   04066 HIF-1 signaling pathway
    740898 (AKT1)
   04068 FoxO signaling pathway
    740898 (AKT1)
   04072 Phospholipase D signaling pathway
    740898 (AKT1)
   04071 Sphingolipid signaling pathway
    740898 (AKT1)
   04024 cAMP signaling pathway
    740898 (AKT1)
   04022 cGMP-PKG signaling pathway
    740898 (AKT1)
   04151 PI3K-Akt signaling pathway
    740898 (AKT1)
   04152 AMPK signaling pathway
    740898 (AKT1)
   04150 mTOR signaling pathway
    740898 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    740898 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    740898 (AKT1)
   04218 Cellular senescence
    740898 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    740898 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    740898 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    740898 (AKT1)
   04613 Neutrophil extracellular trap formation
    740898 (AKT1)
   04620 Toll-like receptor signaling pathway
    740898 (AKT1)
   04625 C-type lectin receptor signaling pathway
    740898 (AKT1)
   04660 T cell receptor signaling pathway
    740898 (AKT1)
   04662 B cell receptor signaling pathway
    740898 (AKT1)
   04664 Fc epsilon RI signaling pathway
    740898 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    740898 (AKT1)
   04062 Chemokine signaling pathway
    740898 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    740898 (AKT1)
   04922 Glucagon signaling pathway
    740898 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    740898 (AKT1)
   04920 Adipocytokine signaling pathway
    740898 (AKT1)
   04929 GnRH secretion
    740898 (AKT1)
   04915 Estrogen signaling pathway
    740898 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    740898 (AKT1)
   04917 Prolactin signaling pathway
    740898 (AKT1)
   04926 Relaxin signaling pathway
    740898 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    740898 (AKT1)
   04919 Thyroid hormone signaling pathway
    740898 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    740898 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    740898 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    740898 (AKT1)
   04728 Dopaminergic synapse
    740898 (AKT1)
   04722 Neurotrophin signaling pathway
    740898 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    740898 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    740898 (AKT1)
   04213 Longevity regulating pathway - multiple species
    740898 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    740898 (AKT1)
   05205 Proteoglycans in cancer
    740898 (AKT1)
   05230 Central carbon metabolism in cancer
    740898 (AKT1)
   05231 Choline metabolism in cancer
    740898 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    740898 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    740898 (AKT1)
   05212 Pancreatic cancer
    740898 (AKT1)
   05225 Hepatocellular carcinoma
    740898 (AKT1)
   05226 Gastric cancer
    740898 (AKT1)
   05214 Glioma
    740898 (AKT1)
   05221 Acute myeloid leukemia
    740898 (AKT1)
   05220 Chronic myeloid leukemia
    740898 (AKT1)
   05218 Melanoma
    740898 (AKT1)
   05211 Renal cell carcinoma
    740898 (AKT1)
   05215 Prostate cancer
    740898 (AKT1)
   05213 Endometrial cancer
    740898 (AKT1)
   05224 Breast cancer
    740898 (AKT1)
   05222 Small cell lung cancer
    740898 (AKT1)
   05223 Non-small cell lung cancer
    740898 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    740898 (AKT1)
   05017 Spinocerebellar ataxia
    740898 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    740898 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    740898 (AKT1)
   04931 Insulin resistance
    740898 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    740898 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    740898 (AKT1)
   05135 Yersinia infection
    740898 (AKT1)
   05152 Tuberculosis
    740898 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    740898 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    740898 (AKT1)
   05161 Hepatitis B
    740898 (AKT1)
   05160 Hepatitis C
    740898 (AKT1)
   05164 Influenza A
    740898 (AKT1)
   05162 Measles
    740898 (AKT1)
   05168 Herpes simplex virus 1 infection
    740898 (AKT1)
   05163 Human cytomegalovirus infection
    740898 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    740898 (AKT1)
   05169 Epstein-Barr virus infection
    740898 (AKT1)
   05165 Human papillomavirus infection
    740898 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    740898 (AKT1)
   05142 Chagas disease
    740898 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    740898 (AKT1)
   01524 Platinum drug resistance
    740898 (AKT1)
   01522 Endocrine resistance
    740898 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    740898 (AKT1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     740898 (AKT1)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   740898 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 740898
NCBI-ProteinID: XP_024204724
Ensembl: ENSPTRG00000006775
VGNC: 10319
LinkDB
Position
14
AA seq 480 aa
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcggccacgctacttcctcctcaagaatgatggcaccttcattggctacaaggag
cggccgcaggatgtggaccaacgtgaggcccccctcaacaacttctctgtggcgcagtgc
cagctgatgaagacagagcggcctcggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcatcgaacgcaccttccatgtggagactcctgaggagcgggaggagtggaca
accgccatccagactgtggccgacggcctcaagaagcaggaggaggaggagatggacttc
cggtcgggctcacccagtgacaactcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgcgtgaccatgaacgagtttgagtacctgaagctgctgggcaagggcact
tttggcaaggtgatcctggtgaaggagaaggccacaggccgctactacgccatgaagatc
ctcaagaaggaagtcatcgtggccaaggacgaggtggcccacacactcaccgagaaccgc
gtcctgcagaactccaggcaccccttcctcacagccctgaagtactctttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacgggggcgagctgttcttccacctgtcc
cgggagcgtgtgttctccgaggaccgggcccgcttctatggcgctgagatcgtgtcagcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggacggtgccaccatgaagaccttttgtggcacacccgagtacctggcccccgaggtg
ctggaggacaatgactacggccgtgcagtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccatgagaagctttttgagctc
atcctcatggaggagatccgcttcccgcgcacgcttggtcccgaggccaagtccttgctt
tcggggctgctcaagaaggaccccaagcagaggcttggcgggggctccgaggacgccaag
gagatcatgcagcatcgcttctttgccggtatcgtgtggcagcacgtgtacgagaagaag
ctcagcccacccttcaagccccaggtcacatcggagactgacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacaccacctgaccaagatgacagcatggagtgt
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

DBGET integrated database retrieval system