KEGG   Pan troglodytes (chimpanzee): 100610135
Entry
100610135         CDS       T01005                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00564  Glycerophospholipid metabolism
ptr00565  Ether lipid metabolism
ptr00590  Arachidonic acid metabolism
ptr00591  Linoleic acid metabolism
ptr00592  alpha-Linolenic acid metabolism
ptr01100  Metabolic pathways
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04217  Necroptosis
ptr04270  Vascular smooth muscle contraction
ptr04370  VEGF signaling pathway
ptr04611  Platelet activation
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04724  Glutamatergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04921  Oxytocin signaling pathway
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100610135 (PLA2G4D)
   00565 Ether lipid metabolism
    100610135 (PLA2G4D)
   00590 Arachidonic acid metabolism
    100610135 (PLA2G4D)
   00591 Linoleic acid metabolism
    100610135 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    100610135 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100610135 (PLA2G4D)
   04014 Ras signaling pathway
    100610135 (PLA2G4D)
   04370 VEGF signaling pathway
    100610135 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    100610135 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100610135 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100610135 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    100610135 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    100610135 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100610135 (PLA2G4D)
   04913 Ovarian steroidogenesis
    100610135 (PLA2G4D)
   04921 Oxytocin signaling pathway
    100610135 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100610135 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100610135 (PLA2G4D)
   04726 Serotonergic synapse
    100610135 (PLA2G4D)
   04730 Long-term depression
    100610135 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100610135 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100610135 (PLA2G4D)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100610135 (PLA2G4D)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 100610135
NCBI-ProteinID: XP_016783085
Ensembl: ENSPTRG00000006969
VGNC: 8283
LinkDB
Position
15
AA seq 888 aa
MCLVPPGGPATLWPCRIPSWLGLPLPHSPGKGFHKFHPWVGCYSLTAAAQNHDPQNRSGQ
RLFGPQRVSPERLAGVSAPPSTRRVGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQ
LSTAPGMKLKTKTLTDTSHPVWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYD
ISEVLPGKLLRKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVLVARELSCLDVHLDS
TGSTAVVADQDKLELELVLKGSYEDTQTSFLGTASAFHFHYMAALETELSGRVRSSTSNG
WNGDNSAGYLTVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEE
QAFLSRRKQVVAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGL
LDCVTYFSGISGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRR
ELELRAEQGHSTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKEN
NLETLDFKEWVEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNI
FSLNLLDAWYDLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFK
GFLTGRPLHQRSPNFLQGLQLHQDYCSHKDFSTWADCQLDSMPSQLTPQEPRLCLVDAGY
FINTSSPSMFRPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQP
RECHLFSDPACPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSN
MTYKEEDFEHLLRLSDYNVQTSEGAILQALRTALKHRTLEARPPRAQT
NT seq 2667 nt   +upstreamnt  +downstreamnt
atgtgcttggtgcctcctgggggtcctgccaccctgtggccctgcaggatcccctcctgg
ctggggctcccactgccccactccccggggaaggggttccacaaattccacccctgggtg
ggctgctattccctgactgctgcagcccagaaccatgacccccaaaacagaagtggacaa
aggctctttggtccccagagggtgtccccagaacgcctggcaggggtgtcagcaccacca
agtaccaggagagtgggggaggcctctacctgctggcagctcaccgtgagggtcctggag
gcgcggaacctgcgctgggctgacctgttgagtgaggccgacccttacgtgatcctacag
ctgtcgaccgcacctggaatgaagttgaagaccaagacgctcaccgacaccagtcatcct
gtgtggaatgaggccttccgtttccttatccaaagtcaggtcaagaatgttctggagctt
agcatctatgatgaggactcagtcacggaggatgacatctgcttcaaggttctctatgac
atctcagaagtcctccctggcaagctgctccggaaaaccttctcccagagtccccaggga
gaggaggagctggatgtggagttcctgatggaagaaacgtcagatcgcccagaaaacctc
atcaccaacaaagtccttgtggcccgagagctgtcatgcctggatgtgcatctggacagc
acagggagcaccgctgtggttgcagatcaggacaagctggagctggagctggtgctgaag
gggtcctatgaggacacacagacatccttcctgggcacagcctctgccttccacttccac
tacatggcagccctagagacagagctgagcgggcgcgtgaggagctccacaagcaatggc
tggaatggggacaactcagctgggtacctcactgtgcccctgaggcccttgaccattggg
aaggaggtgactatggatgttcctgctccaaatgccccaggagtgaggctgcagctcaag
gcagagggctgccctgaggagctggccgtgcacctgggcttcaatctctgtgcagaggag
caggccttcctgagcaggaggaagcaggtggtggccaaggccctgaagcaggccctgcag
ctggacagagacctgcaggaggatgaggtacccgttgtgggcatcatggccacaggagga
ggtgcccgggccatgacctcgctctacggccacctattggccttgcagaagctgggcctc
ctagactgtgtgacctacttcagtggcatctctggctctacgtggacaatggcccacctg
tacggggaccctgagtggtcgcagagggacctggagggacctatcagatacgcccgggag
cacctggccaagagcaagctggaggtcttttccccagagcgcctggcgagctaccgccgg
gagctggagctgcgggctgagcagggccactccacgacctttgtggacctgtgggcgcta
gtgctggagtccatgctgcacggccaggtgatggatcagaagctgtcaggacagagagcc
gccctggaacggggtcagaaccctctgcccctctacttgagcctcaatgtcaaagagaac
aatctggagacactggacttcaaggagtgggttgagttctccccctatgaggtcggtttc
ctgaagtacggggccttcgtccctcctgagctcttcggctccgagttcttcatgggacgg
ctgatgaggaggatcccggagccccggatctgctttctggaagccatctggagcaacatt
ttctccctgaacctgctggatgcctggtatgacctcaccagttctggggagtcctggaaa
cagcacatcaaggacaagaccaggagcttagagaaggagcccctgaccacctcggggacc
tcctcgcggctggaggcctcgtggctgcagccaggcacggcgctggcccaggcatttaaa
ggcttcctgacaggcaggcccctccaccagcgcagccccaacttcctccagggcctccag
ctgcaccaggactactgtagccacaaagacttctccacctgggcagactgccagcttgac
tccatgcccagccagctgaccccccaggagccccggctctgcctggtggacgccggctac
ttcatcaacaccagctctccctccatgttccggccaggccgcaggctggacctcatcctc
tccttcgactactccctatctgcgcccttcgaggcactgcagcagacggagctgtactgc
cgggcccgggggctgcccttcccccgggtggaacccagccctcaggaccagcaccagcca
agggagtgccacctcttctcagaccccgcctgccccgaggccccgatcctgctgcacttc
ccactggtcaatgcctccttcaaggaccactcagcccccggtgtccagcgcagccccgca
gagctccagggtggccaagtggatctcaccggggccacctgcccctacaccctgtccaac
atgacctacaaggaggaagacttcgagcacctgctgcggctcagtgactacaacgtgcag
accagcgagggtgccatcctgcaggccctgaggaccgcgctgaagcaccggactctagag
gcgaggcctccaagggcacagacctga

KEGG   Pan troglodytes (chimpanzee): 453356
Entry
453356            CDS       T01005                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta isoform X2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00564  Glycerophospholipid metabolism
ptr00565  Ether lipid metabolism
ptr00590  Arachidonic acid metabolism
ptr00591  Linoleic acid metabolism
ptr00592  alpha-Linolenic acid metabolism
ptr01100  Metabolic pathways
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04217  Necroptosis
ptr04270  Vascular smooth muscle contraction
ptr04370  VEGF signaling pathway
ptr04611  Platelet activation
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04724  Glutamatergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04921  Oxytocin signaling pathway
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    453356 (PLA2G4F)
   00565 Ether lipid metabolism
    453356 (PLA2G4F)
   00590 Arachidonic acid metabolism
    453356 (PLA2G4F)
   00591 Linoleic acid metabolism
    453356 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    453356 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    453356 (PLA2G4F)
   04014 Ras signaling pathway
    453356 (PLA2G4F)
   04370 VEGF signaling pathway
    453356 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    453356 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    453356 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    453356 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    453356 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    453356 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    453356 (PLA2G4F)
   04913 Ovarian steroidogenesis
    453356 (PLA2G4F)
   04921 Oxytocin signaling pathway
    453356 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    453356 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    453356 (PLA2G4F)
   04726 Serotonergic synapse
    453356 (PLA2G4F)
   04730 Long-term depression
    453356 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    453356 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    453356 (PLA2G4F)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     453356 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 453356
NCBI-ProteinID: XP_009427162
Ensembl: ENSPTRG00000006970
VGNC: 8285
LinkDB
Position
15
AA seq 690 aa
MLWALRPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGLPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPRGEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLCDGEQKFLDRRKQVVSKALQQVLGLSEAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVREHSGHSVSLIDLWGLLVEYFLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTQGLCLHKDYVAGREFVAWKGL
PVPGGRRLCHQLSVPTGSAASESSGPHSVL
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgctttgggcactccggccaaggtggctggcagacaagatgctgcccctcctgggggca
gtgctgcttcagaagagagagaagaggggccctctgtggaggcactggcggcgggaaacc
tacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcacagac
ctgctgtccaaagccgactgctatgtgcaactgtggctgcccacggcgtccccaagccct
gcccagactaggatagtggccaactgcagtgaccccgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaacgtcctggagctcaccctgtatgacaaggacatcctg
ggcagcgaccagctctctctgctcctgtttgacctgagaagcctcaagtgtggcctacct
cacaaacacaccttcccactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacactccggggagatgggacagccccacggggagagtac
ggctctaggcagctccagctggcagtgcctggggcctacgagaagccacagctcttgccc
ctgcagcctcccacagagccaggcctcccacccacctttaccttccacgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagctgctggcggctgtgcagagtggcccc
agcgcggagctggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggaggaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagcatgaaggtggaaatgagctccggggacctagacctacgccttggctttgacctc
tgtgacggggagcagaagtttctggacaggaggaagcaggtcgtgtccaaggccctgcag
caagtgctgggattgagtgaggctccggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcttctctgtacggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacactcaggaactgggggtccgggagcacagtggccacagcgtgtccctcatcgac
ctctggggcctccttgttgagtatttcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcagtccgccagggtcagaacccttaccccatttacaccagcgtcaac
gtccgcaccaacttgagtggagaagattttgcagagtggtgcgagttcacgccctatgag
gtaggcttccccaagtacggggcttatgttcccaccgagctcttcggctcagaactcttc
atgggacgattgctgcagctccagcctgaaccccggatctgttacctgcaaggtatgtgg
ggcagcgcctttgccaccagcctggatgagatcttcctaaagaccgccggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagacgactgccagaagcctcag
ctgcacaacccctcgaggctgcgaacgaggctcctcaccccgcaggggcccttctcccag
gctgtgctggacatattcacctcccgcttcacttccgcccagagctttaacttcacccag
ggtctctgcttgcacaaggactatgtggctggcagggagttcgtggcctggaaaggactg
cctgtacctggtggacggaggctttgccatcaactctccgttcccactggctctgctgcc
tcagagagcagtggacctcattctgtcctttga

KEGG   Pan troglodytes (chimpanzee): 467664
Entry
467664            CDS       T01005                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00564  Glycerophospholipid metabolism
ptr00565  Ether lipid metabolism
ptr00590  Arachidonic acid metabolism
ptr00591  Linoleic acid metabolism
ptr00592  alpha-Linolenic acid metabolism
ptr01100  Metabolic pathways
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04217  Necroptosis
ptr04270  Vascular smooth muscle contraction
ptr04370  VEGF signaling pathway
ptr04611  Platelet activation
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04724  Glutamatergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04921  Oxytocin signaling pathway
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    467664 (PLA2G4E)
   00565 Ether lipid metabolism
    467664 (PLA2G4E)
   00590 Arachidonic acid metabolism
    467664 (PLA2G4E)
   00591 Linoleic acid metabolism
    467664 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    467664 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    467664 (PLA2G4E)
   04014 Ras signaling pathway
    467664 (PLA2G4E)
   04370 VEGF signaling pathway
    467664 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    467664 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    467664 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    467664 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    467664 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    467664 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    467664 (PLA2G4E)
   04913 Ovarian steroidogenesis
    467664 (PLA2G4E)
   04921 Oxytocin signaling pathway
    467664 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    467664 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    467664 (PLA2G4E)
   04726 Serotonergic synapse
    467664 (PLA2G4E)
   04730 Long-term depression
    467664 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    467664 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    467664 (PLA2G4E)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     467664 (PLA2G4E)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 467664
NCBI-ProteinID: XP_016783491
Ensembl: ENSPTRG00000006967
VGNC: 8284
UniProt: H2Q988
LinkDB
Position
15
AA seq 868 aa
MSLQASEGCPGLGTNVFVPQSPQRGEEGSRSGRSFSEFEHTQDLDTPGLPPFYPMAPWGS
EEGLSPCHLLTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
SFNFQIQSRVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGMEEL
EVEFLLEESPSPPETLVTNGVLVSRQVSCLEVHAQSRRRRKREKMKDLLVMVNESFENTQ
RVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCCSRKNGPISQPLD
CLSDGQVMTLPVGESYELHMKSTPCPETLDVRLGFSLCPAELEFLQKRKVVVAKALKQVL
QLEEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMAT
LYRDPDWSSKNLEPAIFEARRHVVKDKLPSLFPDQLRKFQEELRQRSQEGYRVTFTDFWG
LLIETCLGDERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGL
QKYGAFIPSELFGSEFFMGRLVKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFFH
RWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSFREILTHRSFVSEFHNFLS
GLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKAD
LIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVT
FFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYN
ILNNKDTLLQALRLAVEKKKRLKGQCPS
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgagtctccaggcctcggaaggctgtcctggcctgggaactaatgtgtttgtcccacag
agcccacaaaggggtgaagaaggcagcaggtcaggaagaagtttcagtgagttcgagcat
acacaggacctggacactcctggtctcccacctttctatcctatggctccttggggctct
gaggaggggctgtctccatgccacctgttgacagtgagggtcatccggatgaaaaatgtc
cggcaggctgatatgctgagccagacagactgttttgtgagcctctggctgcccaccgcc
tctcagaagaagctgaggacaaggaccatctccaactgcccaaatccagagtggaatgaa
agcttcaacttccagatccagagccgagtgaagaacgtgctagagttgagtgtctgtgat
gaagacacagtgacaccagatgaccatctcctgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccacgtgaagtttccactcaacccgcagggcatggaagagctg
gaggtggagttcttgctggaggagagtccctctccacctgagaccctcgtcaccaatggc
gtgctggtgtctcgacaagtctcctgcctggaggttcatgcacaatccaggaggcggagg
aagagggagaaaatgaaggacctcctggtgatggtgaacgaatcctttgagaacacccag
cgtgtccggccctgcttggaaccctgctgcccaacttctgcctgcttccaaactgctgcc
tgcttccactaccccaagtacttccagtcccaggtgcacgtggaagtgcccaagagtcat
tggagctgtgggctttgctgctgctctcgcaagaatggccccatcagccagcccctcgac
tgcctttccgatggtcaggtgatgaccctgcctgtgggtgagagttatgaattacacatg
aagtctacaccctgccctgagacactggacgtgcggctgggcttcagcctgtgcccagca
gagctggagtttctgcagaagcggaaggtcgtggtggccaaggccctgaagcaggtgctg
cagctggaggaagacctgcaggaggatgaggtgccgctgatagccatcatggccactggg
ggtggaacaagatccatgacctccatgtatggccacctgctggggctgcagaagctgaac
ctcctggactgtgccagctacatcactggtctatcaggggccacctggaccatggctacc
ttgtaccgtgaccctgactggtcctccaaaaacttggagcctgctatctttgaggctcgg
agacatgtggtaaaggacaagctaccctccctgttcccagaccagctccgcaaattccag
gaggagctccggcagcgcagccaggaaggctacagggtcacctttacagacttctggggc
ctgctgatagagacctgcctgggggacgagagaaatgaatgcaaactgtcagatcagcgt
gctgctttgagctgcggccagaaccccctgcccatctacctcaccatcaatgtcaaggat
gatgtaagcaaccaggacttcagagagtggttcgagttctccccctacgaggtgggcctc
cagaagtatggggccttcatcccctccgagctcttcggctccgagttcttcatggggcgg
ctggtgaagaggatcccggagtctcgaatctgctacatgctaggcctgtggagcagcatc
ttctccctgaacctgctggatgcctggaacctgtcacacacctcggaggagtttttccac
aggtggacaagggagaaagtgcaggacatcgaagatgagccgatcctgcctgaaatcccc
aaatgtgatgctaacatcctggagaccacggtagtgatcccagggtcgtggctgtccaat
tctttccgagaaatccttacccatcggtccttcgtgtctgagtttcacaacttcctgtct
gggctgcagctgcacaccaactacctccagaatggccagttctctaggtggaaagacaca
gtgctagatggtttcccaaaccagctgactgagtccgcgaaccacctgtgcctgctggac
actgcgttctttgtcaactccagctacccgcccctcctcaggccagagcgaaaagccgac
ctcatcatccacctcaactactgtgctgggtcccagacaaagcccctgaaacaaacttgt
gagtactgcactgtgcagaacatccccttccccaaatacgagctgccagatgagaatgaa
aatctcaaggaatgctacctgatggagaacccccaggaacccgatgcccccatcgtgact
ttcttcccactcatcaatgacactttccgaaaatacaaggcaccaggtgtagagcgaagc
cctgaggagctggagcagggccaggtggacatttatggtcccaaaactccctatgccacc
aaggagctgacatacacagaggccacctttgacaagctggtgaaactctctgagtataac
atcctgaataataaggacactctcctccaggctctgcggctcgcagtggagaagaagaag
cgcctgaagggccagtgtccctcctag

KEGG   Pan troglodytes (chimpanzee): 468935
Entry
468935            CDS       T01005                                 

Gene name
PLA2G4C
Definition
(RefSeq) cytosolic phospholipase A2 gamma isoform X4
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00564  Glycerophospholipid metabolism
ptr00565  Ether lipid metabolism
ptr00590  Arachidonic acid metabolism
ptr00591  Linoleic acid metabolism
ptr00592  alpha-Linolenic acid metabolism
ptr01100  Metabolic pathways
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04217  Necroptosis
ptr04270  Vascular smooth muscle contraction
ptr04370  VEGF signaling pathway
ptr04611  Platelet activation
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04724  Glutamatergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04921  Oxytocin signaling pathway
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    468935 (PLA2G4C)
   00565 Ether lipid metabolism
    468935 (PLA2G4C)
   00590 Arachidonic acid metabolism
    468935 (PLA2G4C)
   00591 Linoleic acid metabolism
    468935 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    468935 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    468935 (PLA2G4C)
   04014 Ras signaling pathway
    468935 (PLA2G4C)
   04370 VEGF signaling pathway
    468935 (PLA2G4C)
   04072 Phospholipase D signaling pathway
    468935 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    468935 (PLA2G4C)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    468935 (PLA2G4C)
   04664 Fc epsilon RI signaling pathway
    468935 (PLA2G4C)
   04666 Fc gamma R-mediated phagocytosis
    468935 (PLA2G4C)
  09152 Endocrine system
   04912 GnRH signaling pathway
    468935 (PLA2G4C)
   04913 Ovarian steroidogenesis
    468935 (PLA2G4C)
   04921 Oxytocin signaling pathway
    468935 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    468935 (PLA2G4C)
  09156 Nervous system
   04724 Glutamatergic synapse
    468935 (PLA2G4C)
   04726 Serotonergic synapse
    468935 (PLA2G4C)
   04730 Long-term depression
    468935 (PLA2G4C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    468935 (PLA2G4C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    468935 (PLA2G4C)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     468935 (PLA2G4C)
SSDB
Motif
Pfam: PLA2_B
Other DBs
NCBI-GeneID: 468935
NCBI-ProteinID: XP_016791844
Ensembl: ENSPTRG00000011223
VGNC: 3622
LinkDB
Position
19
AA seq 552 aa
MGSSEVSVIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPAVAVLGSGGGLRAHIACL
GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSL
QKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQ
PSWQEARAPETWFEFTPHHAGFPALGAFVSITHFGSKFKKGRLVRTHPERDLTFLRGLWG
SALGNTEVIREYIFDKHSSCFYSFADQLRNLTLKGLWRRAVANAKSIGHLLFARLLRLQE
SSQGEHPPPEDEGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNFMDFVKKTG
ICASKWEWGTTHNFLYKHSGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILS
FDFSAGDPFETIRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPL
FNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLY
YPKDSARSCCLA
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgggaagctctgaagtttccgtaattcctgggctccagaaagaagaaaaggcggccgtg
gagagacgaagacttcatgtgctgaaagctctgaagaagctaaggattgaggctgatgag
gccccagctgttgctgtgctgggctcaggcggaggactgcgggctcacattgcctgcctt
ggggtcctgagtgagatgaaagaacagggcctgttggatgctgtcacgtacctcgcaggg
gtctctggatccacttgggcaatatcttctctctacaccaacgacggtgacatggaagct
ctcgaggctgacctgaaacatcgatttacccgacaggagtgggacttggctaagagccta
cagaaaaccatccaagcagcgaggtctgagaattactctctgaccgacttctgggcctac
atggttatctctaagcaaaccagagaactgccggagtctcatttgtccaatatgaagaag
cccgtggaagaagggacactaccctacccgatatttgcagccattgacaatgacctgcaa
ccttcctggcaggaggcaagagcaccagagacctggttcgagttcacccctcaccacgct
ggcttccctgcactgggggcctttgtttccataacccacttcggaagcaaattcaagaag
ggaagactggtcagaactcaccctgagagagacctgactttcctgagaggtttatgggga
agtgctctcggtaacactgaagtcattagggaatacatttttgataaacattcctcctgc
ttctactctttcgcagaccagttaaggaatctgaccctgaaaggtttatggagaagggct
gttgctaatgctaaaagcattggacaccttctttttgcccgattactgaggctgcaagaa
agttcgcaaggggaacatcctcccccagaagatgaaggcggtgagcctgaacacacctgg
ctgactgagatgctcgagaattggaccaggacctccctggaaaagcaggagcagccccat
gaggaccccgaaaggaaaggctcactcagtaactttatggattttgtgaagaaaacaggc
atttgcgcttcaaagtgggaatgggggaccactcacaacttcctgtacaaacacagtggc
atccgggacaagataatgagcagccggaagcacctccacctggtggatgctggtttagcc
atcaacactcccttcccactcgtgctgcccccgacgcgggaggttcacctcatcctctcc
ttcgacttcagtgccggagatcctttcgagaccatccgggctaccactgactattgccgc
cgccacaagatcccctttccccaagtagaagaggctgagctggatttgtggtccaaggcc
cccgccagctgctacatcctgaaaggagaaactggaccagtggtgatgcattttcccctg
ttcaacatagatgcctgtggaggtgatattgaggcatggagtgacacatacgacacattc
aagctcgctgacacctacactctagatgtggtggtgctactcttggcattagccaagaag
aatgtcagggaaaacaagaagaagatccttagagagttgatgaacgtggccgggctctac
tacccgaaggatagtgcccgaagttgctgcttggcatag

KEGG   Pan troglodytes (chimpanzee): 469617
Entry
469617            CDS       T01005                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2 isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00564  Glycerophospholipid metabolism
ptr00565  Ether lipid metabolism
ptr00590  Arachidonic acid metabolism
ptr00591  Linoleic acid metabolism
ptr00592  alpha-Linolenic acid metabolism
ptr01100  Metabolic pathways
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04217  Necroptosis
ptr04270  Vascular smooth muscle contraction
ptr04370  VEGF signaling pathway
ptr04611  Platelet activation
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04724  Glutamatergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04921  Oxytocin signaling pathway
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    469617 (PLA2G4A)
   00565 Ether lipid metabolism
    469617 (PLA2G4A)
   00590 Arachidonic acid metabolism
    469617 (PLA2G4A)
   00591 Linoleic acid metabolism
    469617 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    469617 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    469617 (PLA2G4A)
   04014 Ras signaling pathway
    469617 (PLA2G4A)
   04370 VEGF signaling pathway
    469617 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    469617 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    469617 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    469617 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    469617 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    469617 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    469617 (PLA2G4A)
   04913 Ovarian steroidogenesis
    469617 (PLA2G4A)
   04921 Oxytocin signaling pathway
    469617 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    469617 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    469617 (PLA2G4A)
   04726 Serotonergic synapse
    469617 (PLA2G4A)
   04730 Long-term depression
    469617 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    469617 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    469617 (PLA2G4A)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     469617 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 469617
NCBI-ProteinID: XP_001165694
Ensembl: ENSPTRG00000001787
VGNC: 9881
UniProt: H2Q0T0 A0A6D2VZ58
LinkDB
Position
1
AA seq 749 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYKAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcatttatagatccttaccagcacattatagtggagcaccagtattcccacaagttt
acggtagtggtattacgtgccaccaaagtgacaaagggggccttcggtgacatgcttgat
actccagatccctatgtggaactttttatctctacaacccctgacagcaggaagagaaca
agacatttcaataatgacataaaccctgtgtggaatgagacctttgaatttattttggat
cctaatcaggaaaatgttttggagattacgttaatggatgccaattatgtcatggatgaa
actctagggacagcaacatttactgtatcttctatgaaggtgggagagaagaaagaagtt
ccttttattttcaaccaagtcactgaaatggttctagaaatgtctcttgaagtttgctca
tgcccagacctacgatttagtatggctctgtgtgatcaggagaagactttcagacaacag
agaaaagaacacataagggagagcatgaagaaactcttgggtccaaagaatagtgaagga
ttgcattctgcacgtgatgtgcctgtggtagccatattgggttcaggtgggggtttccga
gccatggtgggattctctggtgtgatgaaggcattatacgaatcaggaattctggattgt
gctacctacgttgctggtctttctggctccacctggtatatgtcaaccttgtattctcac
cctgattttccagagaaagggccagaggagattaatgaagaactaatgaaaaatgttagc
cacaatccccttttacttctcacaccacagaaagttaaaagatatgttgagtctttatgg
aagaagaaaagctctggacaacctgtcacctttactgatatctttgggatgttaatagga
gaaacactaattcataatagaatgaatactactctgagcagtttgaaggaaaaagttaat
actgcacaatgccctttacctcttttcacctgtcttcatgtcaaacctgacgtttcagag
ctgatgtttgcagattgggttgaatttagtccatacgaaattggcatggctaaatatggt
acttttatggctcctgacttatttggaagcaaattttttatgggaacagtcgttaagaag
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgccttttccatattg
ttcaacagagttttgggtgtttctggttcacaaagcagaggctccacaatggaggaagaa
ttagaaaatattaccacaaagcatattgtgagtaatgatagctcggacagtgatgatgaa
tcacacgaacccaaaggcactgaaaatgaagatgctggaagtgactatcaaagtgataat
caagcaagttggattcatcgtatgataatggccttggtgagtgattcagctttattcaat
accagagaaggacgtgctgggaaggtacacaacttcatgctgggcttgaatctcaataca
tcttatccactgtctcctttgagtgactttgccacacaggactcctttgatgatgatgaa
ctggatgcagctgtagcagatcctgatgaatttgagcgaatatatgagcctctggatgtc
aaaagtaaaaagattcatgtagtggacagtgggctcacatttaacctgccgtatcccttg
atactgagacctcagagaggggttgatctcataatctcctttgacttttctgcaaggcca
agtgactctagtcctccgttcaaggaacttctacttgcagaaaagtgggctaaaatgaac
aagctcccctttccaaagattgatccttatgtgtttgatcgggaagggctgaaggagtgc
tatgtctttaaacccaagaatcctgatatggagaaagattgcccaaccatcatccacttt
gttctggccaacatcaacttcagaaagtacaaggctccaggtgttccaagggaaactgag
gaagagaaagaaatcgctgactttgatatttttgatgacccggaatcaccattttcaacc
ttcaattttcaatatccaaatcaagcattcaaaagactacatgatcttatgcacttcaat
actctgaacaacattgatgtgataaaagaagccatggttgaaagcattgaatatagaaga
cagaatccatctcgttgctctgtttcccttagtaatgttgaggcaagaagatttttcaac
aaggagtttctaagtaaacccaaagcatag

KEGG   Pan troglodytes (chimpanzee): 747584
Entry
747584            CDS       T01005                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00564  Glycerophospholipid metabolism
ptr00565  Ether lipid metabolism
ptr00590  Arachidonic acid metabolism
ptr00591  Linoleic acid metabolism
ptr00592  alpha-Linolenic acid metabolism
ptr01100  Metabolic pathways
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04217  Necroptosis
ptr04270  Vascular smooth muscle contraction
ptr04370  VEGF signaling pathway
ptr04611  Platelet activation
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04724  Glutamatergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04921  Oxytocin signaling pathway
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    747584
   00565 Ether lipid metabolism
    747584
   00590 Arachidonic acid metabolism
    747584
   00591 Linoleic acid metabolism
    747584
   00592 alpha-Linolenic acid metabolism
    747584
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    747584
   04014 Ras signaling pathway
    747584
   04370 VEGF signaling pathway
    747584
   04072 Phospholipase D signaling pathway
    747584
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    747584
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    747584
   04664 Fc epsilon RI signaling pathway
    747584
   04666 Fc gamma R-mediated phagocytosis
    747584
  09152 Endocrine system
   04912 GnRH signaling pathway
    747584
   04913 Ovarian steroidogenesis
    747584
   04921 Oxytocin signaling pathway
    747584
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    747584
  09156 Nervous system
   04724 Glutamatergic synapse
    747584
   04726 Serotonergic synapse
    747584
   04730 Long-term depression
    747584
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    747584
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    747584
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     747584
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 747584
NCBI-ProteinID: XP_024209762
LinkDB
Position
Unknown
AA seq 784 aa
STCLGLPKVLGLQAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVALWLPMACSHRLQTR
TVKNSSSPVWNQSFHFRIHRQLKNVMELKVFDXDLVTGDDPVLSVLFDAGTLRAGEFRRE
SFSLSPQGEGRLEVEFHLQSLADRGEWLVSNGILVARELSCLHVQLEETGDQKSSEHRVQ
LVVPGSCEGSQEASVGTGTFRFHCPACWEQELCIHLQDAPEEQLKVPLSALPSGQVVRLV
FPTSQEPLMREELKKEAGLRELAMRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQ
EDEIPVVAIMATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLSEDPEW
SQKDLAGPTELLKTQVTKNKLGVLALSQLQRYRQELAERARLGYPSCFTNLWALINEALL
HDEPHDHKLSDQREALSHGQNPLPIYCALNTKGQSLTTLEFGEWCEFSPYEVGFPKYGAF
IPSELFGSEFFMGQLMKRLPDSRICCLEGIWSNLYAANLQESLYWASEPSQFWDCWVRNQ
ANLDKEQVPLLKIEVPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFS
TWKATTLDGLPNQLTPSEPHLCLLDVGYLLNTSCLPLLQPTRDVDLILSLDYNLHGAFQQ
LQLLGRFCQEQGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSDSFREYLA
PGVRRTPEEAAAGEVNLSSSDYPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQ
RRPH
NT seq 2355 nt   +upstreamnt  +downstreamnt
tccacctgcctcggcctcccaaaagtgctgggattacaggcagaggtgtccaggacctgc
ctgctcacggttcgtgtcctgcaggcccatcgcctaccctctaaggacctagtgaccccc
tctgactgctacgtggctctctggctgcccatggcctgcagccacaggctccagacacgc
acggtcaagaacagcagcagccctgtctggaaccagagctttcacttcaggatccacagg
cagctcaagaatgtcatggaactgaaagtctttgacncggacctggtgaccggagatgac
cctgtgttgtcagtactgtttgatgcggggactctgcgggctggggagttccggcgtgag
agcttctcactgagccctcagggtgaggggcgcctggaagttgaatttcacctgcagagt
ctggctgaccgtggcgagtggctcgtcagcaatggcattctggtggcccgggagctctcc
tgcttgcacgttcaactggaggagacaggagaccagaagtcctcagagcacagagttcag
cttgtggttcctgggtcctgtgagggttcgcaggaggcctctgtgggcactggcaccttc
cgcttccactgcccagcctgctgggagcaggagctgtgtattcacctgcaggatgccccc
gaggagcaactaaaggtgccactgagtgccctgccctctggtcaagtggtgaggcttgtc
ttccccacgtcccaggagcccctgatgagagaggagctgaaaaaagaagcaggactgagg
gagctggccatgcgactgggcttcgggccctgtgcagaggagcaggccttcctgagcagg
aggaagcaggtggtggccgcggccttgaggcaggccctgcagctggacggagacctgcag
gaggatgagatcccagtggtagctattatggccactggtggtgggatccgggcaatgact
tccctgtatgggcagctggctggcctgaaggagctgggcctcttggattgcgtctcctac
atcaccggggcctcgggctccacctgggccttggccaacctttctgaggacccagagtgg
tctcagaaggacctggcagggcccactgagttgctgaagacccaggtgaccaagaacaag
ctgggtgtgctggccctcagccagctgcagcggtaccggcaggagctggccgagcgtgcc
cgcttgggctacccaagctgcttcaccaacctgtgggccctcatcaacgaggcgctgctg
catgatgagccccatgatcacaagctctcagatcaacgggaggccctgagtcatggccag
aaccctctgcccatctactgtgccctcaacaccaaagggcagagcctgaccactttggaa
tttggggagtggtgcgagttctctccctacgaggtcggcttccccaagtacggggccttc
atcccctctgagctctttggctccgagttctttatggggcagctgatgaagaggcttcct
gactcccgcatctgctgcttagaaggtatctggagcaacctgtatgcagccaacctccag
gagagcttatactgggcctcagagcccagccagttctgggactgctgggtcaggaaccag
gccaacctggacaaggagcaggtcccccttctgaagatagaagtaccaccctcaacagcc
ggcaggatagctgagtttttcaccgatcttctgacgtggcgtccactggcccaggccaca
cataatttcctgcgtggcctccatttccacaaagactactttcagcatcctcacttctct
acatggaaagctaccactctggatgggctccccaaccagctgacaccctcggagccccac
ctgtgcctgctggatgttggctacctcctcaataccagctgcctgcccctcctgcagccc
actcgggacgtggacctcatcctgtcattggactacaacctccacggagccttccagcag
ttgcagctcctgggccggttctgccaggagcaggggatcccattcccacccatctcgccc
agccccgaagaacagctccagcctcgggagtgccacaccttctccgaccccacctgcccc
ggagcccccgcggtgctgcactttcctctggtcagcgactccttccgggagtacttggcc
cctggggtccggcggacacccgaggaggcggcagctggggaggtgaacctgtcttcatcg
gactatccctaccactacacgaaggtgacctacagccaggaggacgtggacaagctcctg
cacctgacacattacaatgtctgcaacaaccaggagcagctgctggaggctctgcgccag
cgcaggccccactga

DBGET integrated database retrieval system