KEGG   Pan troglodytes (chimpanzee): 100610220Help
Entry
100610220         CDS       T01005                                 

Definition
(RefSeq) polycomb complex protein BMI-1
  KO
K11459  polycomb group RING finger protein 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr05202  Transcriptional misregulation in cancer
ptr05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100610220
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100610220
   05206 MicroRNAs in cancer
    100610220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    100610220
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     100610220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 Prok-RING_4 zf-RING_UBOX zf-C3HC4_4 zf-RING_10 zf-Nse
Motif
Other DBs
NCBI-GeneID: 100610220
NCBI-ProteinID: XP_024213798
LinkDB All DBs
Position
7
AA seq 326 aa AA seqDB search
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFANRPRKSSVNGSSATSSG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgaacaacgagaatcaagatcactgagctaaatccccacctgatgtgtgtgctt
tgtggagggtacttcattgatgccacaaccataatagaatgtctacattccttctgtaaa
acgtgtattgttcgttacctggagaccagcaagtattgtcctatttgtgatgtccaagtt
cacaaaaccagaccactactgaatataaggtcagataaaactctccaagatattgtatac
aaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttttatgcagct
catccttctgctgatgctgccaatggctctaatgaagatagaggagaggttgcagatgaa
gataagagaattataactgatgatgagataataagcttatccattgaattctttgaccag
aacagattggatcggaaagtaaacaaagacaaagagaaatctaaggaggaggtgaatgat
aaaagatacttacgatgcccagcagcaatgactgtgatgcacttaagaaagtttctcaga
agtaaaatggacatacctaatactttccagattgatgtcatgtatgaggaggaaccttta
aaggattattatacactaatggatattgcctacatttatacctggagaaggaatggtcca
cttccattgaaatacagagttcgacctacttgtaaaagaatgaagatcagtcaccagaga
gatggactgacaaatgctggagaactggaaagtgactctggaagtgacaaggccaacagc
ccagcaggaggtattccctccacctcttcttgtttgcctagccccagtactccagtgcag
tctcctcatccacagtttcctcacatttccagtactatgaatggaaccagcaacagcccc
agcggtaaccaccaatcttcttttgccaatagacctcgaaaatcatcagtaaatgggtca
tcagcaacttcttctggttga

DBGET integrated database retrieval system