KEGG   Pan troglodytes (chimpanzee): 100614256
Entry
100614256         CDS       T01005                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X1
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04068  FoxO signaling pathway
ptr04270  Vascular smooth muscle contraction
ptr04650  Natural killer cell mediated cytotoxicity
ptr04720  Long-term potentiation
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr05010  Alzheimer disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05034  Alcoholism
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100614256 (ARAF)
   04012 ErbB signaling pathway
    100614256 (ARAF)
   04068 FoxO signaling pathway
    100614256 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100614256 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100614256 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100614256 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    100614256 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100614256 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100614256 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100614256 (ARAF)
   04720 Long-term potentiation
    100614256 (ARAF)
   04730 Long-term depression
    100614256 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100614256 (ARAF)
   05205 Proteoglycans in cancer
    100614256 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100614256 (ARAF)
   05212 Pancreatic cancer
    100614256 (ARAF)
   05225 Hepatocellular carcinoma
    100614256 (ARAF)
   05226 Gastric cancer
    100614256 (ARAF)
   05214 Glioma
    100614256 (ARAF)
   05221 Acute myeloid leukemia
    100614256 (ARAF)
   05220 Chronic myeloid leukemia
    100614256 (ARAF)
   05218 Melanoma
    100614256 (ARAF)
   05211 Renal cell carcinoma
    100614256 (ARAF)
   05219 Bladder cancer
    100614256 (ARAF)
   05215 Prostate cancer
    100614256 (ARAF)
   05213 Endometrial cancer
    100614256 (ARAF)
   05224 Breast cancer
    100614256 (ARAF)
   05223 Non-small cell lung cancer
    100614256 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100614256 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100614256 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    100614256 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100614256 (ARAF)
   05160 Hepatitis C
    100614256 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100614256 (ARAF)
   01522 Endocrine resistance
    100614256 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    100614256 (ARAF)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100614256 (ARAF)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100614256 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 100614256
NCBI-ProteinID: XP_016798738
LinkDB
Position
X
AA seq 611 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELL
TPQGPSLSPGSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLT
GQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLG
YRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEM
QVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQ
GMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAA
EVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKIS
SNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELP
ACLLSAARLVP
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaatggggccgagccatcccgggcagtgggcacc
gtcaaagtatacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtctacgactctctagacaaggccctgaaggtgcggggtctaaatcaggactgctgtgtg
gtctaccgactcatcaagggacgaaagacggtcactgcctgggacacagccattgctccc
ctggatggcgaggagctcattgtcgaggtccttgaagatgtcccgctgaccatgcacaat
tttgtacggaagaccttcttcagcctggcgttctgtgacttctgccttaagtttctgttc
catggcttccgttgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaaccgccaacagttctaccacagtgtccaggat
ttgtccggaggctccagacagcatgaggctccctcgaaccgccccctgaatgagttgcta
accccccagggtcccagcctttcccctggcagcccccgcacccagcactgtgacccggag
cacttccccttccctgccccagccaatgcccccctacagcgcatccgctccacgtccact
cccaacgtccatatggtcagcaccacggcccccatggactccaacctcatccagctcact
ggccagagtttcagcactgatgctgccggtagtagaggaggtagtgatggaaccccccgg
gggagccccagcccagccagcgtgtcctcggggaggaagtccccacattccaagtcacca
gcagagcagcgcgagcggaagtccttggccgatgacaagaagaaagtgaagaacctgggg
taccgggactcaggctattactgggaggtaccacccagtgaggtgcagctgctgaagagg
atcgggacgggctcgtttggcaccgtgtttcgagggcggtggcatggcgatgtggccgtg
aaggtgctcaaggtgtcccagcccacagctgagcaggcccaggctttcaagaatgagatg
caggtgctcaggaagacgagacatgtcaacatcttgctgtttatgggcttcatgacccgg
ccgggatttgccatcatcacacagtggtgtgagggctccagcctctaccatcacctgcat
gtggccgacacacgcttcgacatggtccagctcatcgacgtggcccggcagactgcccag
ggcatggactacctccatgccaagaacatcatccaccgagatctcaagtctaacaacatc
ttcctacatgaggggctcacggtgaagatcggtgactttggcttggccacagtgaagact
cgatggagcggggcccagcccttggagcagccctcaggatctgtgctgtggatggcagct
gaggtgatccgtatgcaggacccgaacccctacagcttccagtcagacgtctatgcctac
ggggttgtgctctacgagcttatgactggctcactgccttacagccacattggctgccgt
gaccagattatctttatggtgggccgtggctatctgtccccggacctcagcaaaatctcc
agcaactgccccaaggccatgcggcgcctgctgtctgactgcctcaagttccagcgggag
gagcggcccctcttcccccagatcctggccacaattgagctgctgcaacggtcactcccc
aagattgagcggagtgcctcggaaccctccttgcaccgcacccaggccgatgagttgcct
gcctgcctactcagcgcagcccgccttgtgccttag

KEGG   Pan troglodytes (chimpanzee): 460182
Entry
460182            CDS       T01005                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X2
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04218  Cellular senescence
ptr04270  Vascular smooth muscle contraction
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04371  Apelin signaling pathway
ptr04510  Focal adhesion
ptr04540  Gap junction
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04720  Long-term potentiation
ptr04722  Neurotrophin signaling pathway
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04929  GnRH secretion
ptr04935  Growth hormone synthesis, secretion and action
ptr05010  Alzheimer disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05034  Alcoholism
ptr05132  Salmonella infection
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    460182 (RAF1)
   04012 ErbB signaling pathway
    460182 (RAF1)
   04014 Ras signaling pathway
    460182 (RAF1)
   04015 Rap1 signaling pathway
    460182 (RAF1)
   04370 VEGF signaling pathway
    460182 (RAF1)
   04371 Apelin signaling pathway
    460182 (RAF1)
   04630 JAK-STAT signaling pathway
    460182 (RAF1)
   04068 FoxO signaling pathway
    460182 (RAF1)
   04072 Phospholipase D signaling pathway
    460182 (RAF1)
   04071 Sphingolipid signaling pathway
    460182 (RAF1)
   04024 cAMP signaling pathway
    460182 (RAF1)
   04022 cGMP-PKG signaling pathway
    460182 (RAF1)
   04151 PI3K-Akt signaling pathway
    460182 (RAF1)
   04150 mTOR signaling pathway
    460182 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    460182 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    460182 (RAF1)
   04218 Cellular senescence
    460182 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    460182 (RAF1)
   04540 Gap junction
    460182 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    460182 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    460182 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    460182 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    460182 (RAF1)
   04660 T cell receptor signaling pathway
    460182 (RAF1)
   04662 B cell receptor signaling pathway
    460182 (RAF1)
   04664 Fc epsilon RI signaling pathway
    460182 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    460182 (RAF1)
   04062 Chemokine signaling pathway
    460182 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    460182 (RAF1)
   04929 GnRH secretion
    460182 (RAF1)
   04912 GnRH signaling pathway
    460182 (RAF1)
   04915 Estrogen signaling pathway
    460182 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    460182 (RAF1)
   04917 Prolactin signaling pathway
    460182 (RAF1)
   04921 Oxytocin signaling pathway
    460182 (RAF1)
   04926 Relaxin signaling pathway
    460182 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    460182 (RAF1)
   04919 Thyroid hormone signaling pathway
    460182 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    460182 (RAF1)
   04916 Melanogenesis
    460182 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    460182 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    460182 (RAF1)
   04720 Long-term potentiation
    460182 (RAF1)
   04730 Long-term depression
    460182 (RAF1)
   04722 Neurotrophin signaling pathway
    460182 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    460182 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    460182 (RAF1)
   05206 MicroRNAs in cancer
    460182 (RAF1)
   05205 Proteoglycans in cancer
    460182 (RAF1)
   05230 Central carbon metabolism in cancer
    460182 (RAF1)
   05231 Choline metabolism in cancer
    460182 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    460182 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    460182 (RAF1)
   05212 Pancreatic cancer
    460182 (RAF1)
   05225 Hepatocellular carcinoma
    460182 (RAF1)
   05226 Gastric cancer
    460182 (RAF1)
   05214 Glioma
    460182 (RAF1)
   05221 Acute myeloid leukemia
    460182 (RAF1)
   05220 Chronic myeloid leukemia
    460182 (RAF1)
   05218 Melanoma
    460182 (RAF1)
   05211 Renal cell carcinoma
    460182 (RAF1)
   05219 Bladder cancer
    460182 (RAF1)
   05215 Prostate cancer
    460182 (RAF1)
   05213 Endometrial cancer
    460182 (RAF1)
   05224 Breast cancer
    460182 (RAF1)
   05223 Non-small cell lung cancer
    460182 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    460182 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    460182 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    460182 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    460182 (RAF1)
   05152 Tuberculosis
    460182 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    460182 (RAF1)
   05161 Hepatitis B
    460182 (RAF1)
   05160 Hepatitis C
    460182 (RAF1)
   05164 Influenza A
    460182 (RAF1)
   05163 Human cytomegalovirus infection
    460182 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    460182 (RAF1)
   05165 Human papillomavirus infection
    460182 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    460182 (RAF1)
   01522 Endocrine resistance
    460182 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    460182 (RAF1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     460182 (RAF1)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   460182 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 460182
NCBI-ProteinID: XP_009443195
Ensembl: ENSPTRG00000014635
VGNC: 12161
LinkDB
Position
3
AA seq 615 aa
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLFSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVD
SRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPR
GQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVNPTPEQFQAFRNE
VAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTA
QGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMA
PEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKL
YKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTED
INACTLTTSPRLPVF
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagacgatcagcaatggttttggattcaaagatgcc
gtgtttgatggctccagctgcatctctcctacaatagttcagcagtttggctatcagcgc
cgggcatcagatgatggcaaactcacagatccttctaagacaagcaacactatccgtgtt
ttcttgccgaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaaaggtaaaaaagcacgcttagattggaatactgatgctgcgtct
ttaattggagaagaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagacgttcctgaagcttgccttctgtgacatctgtcagaaattcctgctc
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaacatcagacagctcttttctcagcacagatattct
acacctcacgccttcacctttaacacctccagtccctcatctgaaggttccctctcccag
aggcagaggtcgacgtccacacctaatgtccacatggtcagcaccaccctgcctgtggac
agcaggatgattgaggatgcaattcgaagtcacagcgaatcagcctcaccttcagccctg
tccagtagtcccaacaatctgagcccaacaggctggtcacagccgaaaacccccgtgcca
gcacaaagagagcgggcaccagtatctgggacccaggagaaaaacaaaattaggcctcgt
ggacagagagattcaagctattattgggaaatagaagccagtgaagtgatgctgtccact
cggattgggtcaggctcttttggaactgtttataagggtaaatggcacggagatgttgca
gtaaagatcctaaaggttgtcaacccaaccccagagcaattccaggccttcaggaatgag
gtggctgttctgcgcaaaacacggcatgtgaacattctgcttttcatggggtacatgaca
aaggacaacctggcaattgtgacccagtggtgcgagggcagcagcctctacaaacacctg
catgtccaggagaccaagtttcagatgttccagctaattgacattgcccggcagacggct
cagggaatggactatttgcatgcaaagaacatcatccatagagacatgaaatccaacaat
atatttctccatgaaggcttaacagtgaaaattggagattttggtttggcaacagtaaag
tcacgctggagtggttctcagcaggttgaacaacctactggctctgtcctctggatggcc
ccagaggtgatccgaatgcaggataacaacccattcagtttccagtcggatgtctactcc
tatggcatcgtattgtatgaactgatgacgggggagcttccttattctcacatcaacaac
cgagatcagatcatcttcatggtgggccgaggatatgcctccccagatcttagtaagcta
tataagaactgccccaaagcaatgaagaggctggtagctgactgtgtgaagaaagtaaag
gaagagaggcctctttttccccagatcctgtcttccattgagctgctccaacactctcta
ccgaagatcaaccggagcgcttccgagccatccttgcatcgggcagcccacactgaggat
atcaatgcttgcacgctgaccacgtccccgaggctgcctgtcttctag

KEGG   Pan troglodytes (chimpanzee): 463781
Entry
463781            CDS       T01005                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04068  FoxO signaling pathway
ptr04150  mTOR signaling pathway
ptr04270  Vascular smooth muscle contraction
ptr04510  Focal adhesion
ptr04650  Natural killer cell mediated cytotoxicity
ptr04720  Long-term potentiation
ptr04722  Neurotrophin signaling pathway
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04934  Cushing syndrome
ptr05010  Alzheimer disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05034  Alcoholism
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05216  Thyroid cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    463781 (BRAF)
   04012 ErbB signaling pathway
    463781 (BRAF)
   04015 Rap1 signaling pathway
    463781 (BRAF)
   04068 FoxO signaling pathway
    463781 (BRAF)
   04024 cAMP signaling pathway
    463781 (BRAF)
   04150 mTOR signaling pathway
    463781 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    463781 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    463781 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    463781 (BRAF)
   04062 Chemokine signaling pathway
    463781 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    463781 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    463781 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    463781 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    463781 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    463781 (BRAF)
   04720 Long-term potentiation
    463781 (BRAF)
   04730 Long-term depression
    463781 (BRAF)
   04722 Neurotrophin signaling pathway
    463781 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    463781 (BRAF)
   05205 Proteoglycans in cancer
    463781 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    463781 (BRAF)
   05212 Pancreatic cancer
    463781 (BRAF)
   05225 Hepatocellular carcinoma
    463781 (BRAF)
   05226 Gastric cancer
    463781 (BRAF)
   05214 Glioma
    463781 (BRAF)
   05216 Thyroid cancer
    463781 (BRAF)
   05221 Acute myeloid leukemia
    463781 (BRAF)
   05220 Chronic myeloid leukemia
    463781 (BRAF)
   05218 Melanoma
    463781 (BRAF)
   05211 Renal cell carcinoma
    463781 (BRAF)
   05219 Bladder cancer
    463781 (BRAF)
   05215 Prostate cancer
    463781 (BRAF)
   05213 Endometrial cancer
    463781 (BRAF)
   05224 Breast cancer
    463781 (BRAF)
   05223 Non-small cell lung cancer
    463781 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    463781 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    463781 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    463781 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    463781 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    463781 (BRAF)
   05160 Hepatitis C
    463781 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    463781 (BRAF)
   01522 Endocrine resistance
    463781 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    463781 (BRAF)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     463781 (BRAF)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   463781 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 463781
NCBI-ProteinID: XP_009452635
Ensembl: ENSPTRG00000019769
VGNC: 14003
LinkDB
Position
7
AA seq 756 aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTVTS
SSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQENLQPSSSHHHGS
ICSYFLSLVFVQFVNIKTQFCSSNLFLKIQNFQCIS
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggtggcggcgcggagccgggccaggctctgttcaac
ggggacatggagcccgaggccggcgccggcgccgcggcctcttcggctgcggaccctgcc
attccggaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagag
gccctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctat
gaagaatacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatct
ctggggaacggaactgatttttctgtttctagctctgcatcaatggataccgttacatct
tcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccaca
gatgtggcacggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aacaaacagaggacagtggtacctgcaaggtgtggagttacagtccgagacagtctaaag
aaagcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggagagaagaaaccaattggctgggacactgatatttcctggcttactggagaagaattg
catgtggaagtgttggagaatgttccacttacaacacacaactttgtacgaaaaacgttt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaa
acatgtggttataaatttcaccagcgttgtagtacagaagttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaagaggcgtccttagcagagactgccctaacatctggatcatccccttccgcacccgcc
tcggactctattgggccccaaattctcaccagtccgtctccttcaaaatccattccaatt
ccacagcccttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccga
tcctcatcagctcccaatgtgcatataaacacaatagaacctgtcaatattgatgacttg
attagagaccaaggatttcgtggtgatggaggatcaaccacaggtttgtctgctaccccc
cctgcctcattacctggctcactaactaacgtgaaagccttacagaaatctccaggacct
cagcgagaaaggaagtcatcttcatcctcagaagacaggaatcgaatgaaaacacttggt
agacgggactcgagtgatgattgggagattcctgatgggcagattacagtgggacaaaga
attggatctggatcatttggaacagtctacaagggaaagtggcatggtgatgtggcagtg
aaaatgttgaatgtgacagcacctacacctcagcagttacaagccttcaaaaatgaagta
ggagtactcaggaaaacacgacatgtgaatatcctactcttcatgggctattccacaaag
ccacaactggctattgttacccagtggtgtgagggctccagcttgtatcaccatctccat
atcattgagaccaaatttgagatgatcaaacttatagatattgcacgacagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatata
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagctacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtcatcagaatgcaagataaaaatccatacagctttcagtcagatgtatatgcattt
gggattgttctgtatgaattgatgactggacagttaccttattcaaacatcaacaacagg
gaccagataatttttatggtgggacgaggatacctgtctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagat
gagagaccactctttccccaagagaatttgcagccttcaagtagccaccatcatggcagc
atctgctcttatttcttaagtcttgtgttcgtacaatttgttaacatcaaaacacagttc
tgttcctcaaatctttttttaaagatacaaaatttccaatgcataagctga

DBGET integrated database retrieval system