KEGG   Pan troglodytes (chimpanzee): 100615623
Entry
100615623         CDS       T01005                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04140  Autophagy - animal
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04370  VEGF signaling pathway
ptr04510  Focal adhesion
ptr04722  Neurotrophin signaling pathway
ptr04910  Insulin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr05010  Alzheimer disease
ptr05014  Amyotrophic lateral sclerosis
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05165  Human papillomavirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100615623 (BAD)
   04014 Ras signaling pathway
    100615623 (BAD)
   04370 VEGF signaling pathway
    100615623 (BAD)
   04024 cAMP signaling pathway
    100615623 (BAD)
   04022 cGMP-PKG signaling pathway
    100615623 (BAD)
   04151 PI3K-Akt signaling pathway
    100615623 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100615623 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100615623 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100615623 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100615623 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100615623 (BAD)
   04919 Thyroid hormone signaling pathway
    100615623 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100615623 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100615623 (BAD)
   05203 Viral carcinogenesis
    100615623 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100615623 (BAD)
   05212 Pancreatic cancer
    100615623 (BAD)
   05225 Hepatocellular carcinoma
    100615623 (BAD)
   05221 Acute myeloid leukemia
    100615623 (BAD)
   05220 Chronic myeloid leukemia
    100615623 (BAD)
   05218 Melanoma
    100615623 (BAD)
   05211 Renal cell carcinoma
    100615623 (BAD)
   05215 Prostate cancer
    100615623 (BAD)
   05213 Endometrial cancer
    100615623 (BAD)
   05223 Non-small cell lung cancer
    100615623 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100615623 (BAD)
   05014 Amyotrophic lateral sclerosis
    100615623 (BAD)
   05020 Prion disease
    100615623 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100615623 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100615623 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100615623 (BAD)
   05161 Hepatitis B
    100615623 (BAD)
   05160 Hepatitis C
    100615623 (BAD)
   05162 Measles
    100615623 (BAD)
   05168 Herpes simplex virus 1 infection
    100615623 (BAD)
   05165 Human papillomavirus infection
    100615623 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100615623 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100615623 (BAD)
   01524 Platinum drug resistance
    100615623 (BAD)
   01522 Endocrine resistance
    100615623 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100615623
NCBI-ProteinID: NP_001238857
Ensembl: ENSPTRG00000003830
VGNC: 1614
UniProt: A0A2I3TX80 A0A6D2W145
LinkDB
Position
11
AA seq 168 aa
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagagg
ggcctgggccccagccccgcaggggacgggccctcaggctccggcaagcatcatcgccag
gccccaggcctcctgtgggacgccagtcaccagcaggagcagccaaccagcagcagccat
catggaggcgctggggctgtggagatccggagtcgccacagctcctaccccgcggggacg
gaggacgacgaagggatgggggaggagcccagcccctttcggggccgctcgcgctcggcg
ccccccaacctctgggcagcacagcgctatggccgcgagctccggaggatgagtgacgag
tttgtggactcctttaagaagggacttcctcgcccgaagagcgcgggcacagcaacccag
atgcggcaaagctccagctggacgcgagtcttccagtcctggtgggatcggaacttgggc
aggggaagctccgccccctcccagtga

DBGET integrated database retrieval system