KEGG   Pan troglodytes (chimpanzee): 101058316
Entry
101058316         CDS       T01005                                 

Gene name
RUNX1
Definition
(RefSeq) runt-related transcription factor 1 isoform X1
  KO
K08367  runt-related transcription factor 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04530  Tight junction
ptr04659  Th17 cell differentiation
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101058316 (RUNX1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101058316 (RUNX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101058316 (RUNX1)
   05202 Transcriptional misregulation in cancer
    101058316 (RUNX1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101058316 (RUNX1)
   05220 Chronic myeloid leukemia
    101058316 (RUNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    101058316 (RUNX1)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    101058316 (RUNX1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 101058316
NCBI-ProteinID: XP_003949211
Ensembl: ENSPTRG00000013883
UniProt: A0A6D2XVV6 A0A2I3TUG2
LinkDB
Position
21
AA seq 480 aa
MASDSIFESFPSYPQCFMRECILGMNPSRDVHDASTSRRFTPPSTALSPGKMSEALPLGA
PDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVA
LGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSP
HHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
PISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPV
TSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVG
GERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcttcagacagcatatttgagtcatttccttcgtacccacagtgcttcatgagagaa
tgcatacttggaatgaatccttctagagacgtccacgatgccagcacgagccgccgcttc
acgccgccttccaccgcgctgagcccaggcaagatgagcgaggcgttgccgctgggcgcc
ccggacgccggcgctgccctggccggcaagctgaggagcggcgaccgcagcatggtggag
gtgctggccgaccacccgggcgagctggtgcgcaccgacagccccaacttcctctgctcc
gtgctgcctacgcactggcgctgcaacaagaccctgcccatcgctttcaaggtggtggcc
ctaggggatgttccagatggcactctggtcactgtgatggccggcaatgatgaaaactac
tcggctgagctgagaaatgctaccgcagccatgaagaaccaggttgcaagatttaatgac
ctcaggtttgtcggtcgaagtggaagagggaaaagcttcactctgaccatcactgtcttc
acaaacccaccgcaagtcgccacctaccacagagccatcaaaatcacagtggatgggccc
cgagaacctcgaagacatcggcagaaactagatgatcagaccaagcccgggagcttgtcc
ttttccgagcggctcagtgaactggagcagctgcggcgcacagccatgagggtcagccca
caccacccagcccccacgcccaaccctcgtgcctccctgaaccactccactgcctttaac
cctcagcctcagagtcagatgcaggatacaaggcagatccaaccatccccaccgtggtcc
tacgatcagtcctaccaatacctgggatccattgcctctccttctgtgcacccagcaacg
cccatttcacctggacgtgccagcggcatgacaaccctctctgcagaactttccagtcga
ctctcaacggcacccgacctgacggcgttcagcgacccgcgccagttccccgcgctgccc
tccatctccgacccccgcatgcactatccaggcgccttcacctactccccgacgccggtc
acctcgggcatcggcatcggcatgtcggccatgggctcggccacgcgctaccacacctac
ctgccgccgccctaccccggctcgtcgcaagcgcagggaggcccgttccaagccagctcg
ccctcctaccacctgtactacggcgcctcggccggctcctaccagttctccatggtgggc
ggcgagcgctcgccgccgcgcatcctgccgccctgcaccaacgcctccaccggctccgcg
ctgctcaaccccagcctcccgaaccagagcgacgtggtggaggccgagggcagccacagc
aactcccccaccaacatggcgccctccgcgcgcctggaggaggccgtgtggaggccctac
tga

KEGG   Pan troglodytes (chimpanzee): 460837
Entry
460837            CDS       T01005                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X7
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00310  Lysine degradation
ptr01100  Metabolic pathways
ptr04010  MAPK signaling pathway
ptr05200  Pathways in cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    460837 (MECOM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    460837 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    460837 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    460837 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    460837 (MECOM)
   03036 Chromosome and associated proteins [BR:ptr03036]
    460837 (MECOM)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     460837 (MECOM)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    460837 (MECOM)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     460837 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED zf-C2H2_11 zf-met Zn-ribbon_8 PyrI_C
Other DBs
NCBI-GeneID: 460837
NCBI-ProteinID: XP_003310138
Ensembl: ENSPTRG00000015601
VGNC: 2041
UniProt: A0A6D2Y8J5 A0A2J8P1L6
LinkDB
Position
3
AA seq 1051 aa
MKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQ
KLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKH
PSVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESD
KEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASI
AEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPG
EVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTPATSQDQPLDLSMGSRSRASGTKL
TEPRKNHVFGGKKGSNVESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYL
RPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPNA
LPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHV
RNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKE
DAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLD
EEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSALD
HIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKES
LHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3156 nt   +upstreamnt  +downstreamnt
atgaagagcgaagactatccccatgaaactatggcgccggatatccacgaagaacggcaa
tatcgctgtgaagactgtgaccagctctttgaatctaaggctgaactagcagatcaccaa
aagtttccatgcagtactcctcactcagcattttcaatggttgaagaggactttcagcaa
aaactcgaaagcgagaatgatctccaagagatacacacgatccaggagtgtaaggaatgt
gaccaagtttttcctgatttgcaaagcctggagaaacacatgctgtcacatactgaagag
agggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgccaaggttttc
acggaccctagcaaccttcagcggcacattcgctctcagcatgtcggtgcccgggcccat
gcatgcccggagtgtggcaaaacgtttgccacttcgtcgggcctcaaacaacacaagcac
atccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcagttt
tcaaacctttgccgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgtgag
ggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctggaacc
ccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgctgac
tattttggcgccaataggcatcctgctggtcttacctttccaacagctcctggattttct
tttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttgatacctgct
agttctcctgttaaaggactatcaagtactgaacagacaaacaaaagtcaaagtcccctc
atgacacatcctcagatactgccagctacacaggatattttgaaggcactatctaaacac
ccatctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagagagg
ccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacacca
agtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacattgaaagtgat
aaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcagaat
ctggcttcaataaataataagaaagaatacagcaatcattccattttctcaccatcttta
gaggagcagactgcggtgtcaggagctgtgaatgattctataaaggctattgcttctatt
gctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaagttggagct
ttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatgtac
ccatttcctgatagagacttgagatcgttacctttgaaaatggaaccccaatcaccaggt
gaagtaaagaaactgcagaagggcagctctgagtccccctttgatctcaccactaagcga
aaggacgagaagcccttgactccagtcccctccaagcctccagtgacacctgccacaagc
caagaccagcccctggatctaagtatgggcagtaggagtagagccagtgggacaaagctg
actgagcctcgaaaaaaccacgtgtttgggggaaaaaaaggaagcaacgtcgaatcaaga
cctgcttcagatggttccttgcagcatgcaagacccactcctttctttatggaccctatt
tacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagagaaatacttg
aggccttctccaggattcttgtttcacccacaattccaactgcctgatcagagaacttgg
atgtcagctattgaaaacatggcagaaaagctagagagcttcagtgccctgaaacctgag
gccagtgagctcttacagtcagtgccctctatgttcaacttcagggcgcctcccaatgcc
ctgccagagaaccttctgcggaagggaaaggagcgctatacctgcagatactgtggcaag
atttttccaaggtctgcaaacctaacacggcacttgagaacccacacaggagagcagcct
tacagatgcaaatactgtgacagatcatttagcatatcttctaacttgcaaaggcatgtt
cgcaacatccacaataaagagaagccatttaagtgtcacttatgtgataggtgttttggt
caacaaaccaatttagacagacacctaaagaaacatgagaatgggaacatgtccggtaca
gcaacatcatcgcctcattctgaactggaaagtacaggtgcgattctggatgacaaagaa
gatgcttacttcacagaaattcgaaatttcattgggaacagcaatcatggcagccaatct
cccaggaatgtggaggagagaatgaatggcagtcattttaaagatgaaaaggctttggtg
accagtcaaaattcagacttgctggatgatgaagaagttgaagatgaggtgttgttagat
gaggaggatgaagacaatgatattactggaaaaacaggaaaggaaccagtgacaagtaat
ttacatgaaggaaaccctgaggatgactatgaagaaaccagtgccctggagatgagttgc
aagacatccccagtgaggtataaagaggaagaatataaaagtggactttctgctctagat
catataaggcacttcacagatagcctcaaaatgaggaaaatggaagataatcagtattct
gaagctgagctgtcttcttttagtacttcccatgtgccagaggaacttaagcagccgtta
cacagaaagtccaaatcgcaggcatatgctatgatgctgtcactgtctgacaaggagtcc
ctccattctacatcccacagttcttccaacgtgtggcacagtatggccagggctgcggcg
gaatccagtgctatccagtccataagccacgtatga

DBGET integrated database retrieval system