KEGG   Pan troglodytes (chimpanzee): 104001067
Entry
104001067         CDS       T01005                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04012  ErbB signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04218  Cellular senescence
ptr04630  JAK-STAT signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04934  Cushing syndrome
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05216  Thyroid cancer
ptr05217  Basal cell carcinoma
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104001067 (CDKN1A)
   04630 JAK-STAT signaling pathway
    104001067 (CDKN1A)
   04066 HIF-1 signaling pathway
    104001067 (CDKN1A)
   04068 FoxO signaling pathway
    104001067 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    104001067 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104001067 (CDKN1A)
   04115 p53 signaling pathway
    104001067 (CDKN1A)
   04218 Cellular senescence
    104001067 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104001067 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    104001067 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104001067 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    104001067 (CDKN1A)
   05206 MicroRNAs in cancer
    104001067 (CDKN1A)
   05205 Proteoglycans in cancer
    104001067 (CDKN1A)
   05203 Viral carcinogenesis
    104001067 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104001067 (CDKN1A)
   05212 Pancreatic cancer
    104001067 (CDKN1A)
   05225 Hepatocellular carcinoma
    104001067 (CDKN1A)
   05226 Gastric cancer
    104001067 (CDKN1A)
   05214 Glioma
    104001067 (CDKN1A)
   05216 Thyroid cancer
    104001067 (CDKN1A)
   05220 Chronic myeloid leukemia
    104001067 (CDKN1A)
   05217 Basal cell carcinoma
    104001067 (CDKN1A)
   05218 Melanoma
    104001067 (CDKN1A)
   05211 Renal cell carcinoma
    104001067 (CDKN1A)
   05219 Bladder cancer
    104001067 (CDKN1A)
   05215 Prostate cancer
    104001067 (CDKN1A)
   05213 Endometrial cancer
    104001067 (CDKN1A)
   05224 Breast cancer
    104001067 (CDKN1A)
   05222 Small cell lung cancer
    104001067 (CDKN1A)
   05223 Non-small cell lung cancer
    104001067 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104001067 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104001067 (CDKN1A)
   05161 Hepatitis B
    104001067 (CDKN1A)
   05160 Hepatitis C
    104001067 (CDKN1A)
   05163 Human cytomegalovirus infection
    104001067 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104001067 (CDKN1A)
   05169 Epstein-Barr virus infection
    104001067 (CDKN1A)
   05165 Human papillomavirus infection
    104001067 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104001067 (CDKN1A)
   01522 Endocrine resistance
    104001067 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104001067
NCBI-ProteinID: XP_003950875
Ensembl: ENSPTRG00000018107
VGNC: 8159
UniProt: H2QSW8
LinkDB
Position
6
AA seq 164 aa
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagaaccggctggggatgtccgtcagaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgcatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccacg
gggccccggcgaggccgggatgagttgggaggaggcaggcggcctggcacctcacctgct
ctgctgcaggggacagcagaggaagaccatgtggacctgtcactgtcttgtacccttgtg
cctcgctcaggggagcaggctgaagggtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system