KEGG   Pan troglodytes (chimpanzee): 104003820
Entry
104003820         CDS       T01005                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04015  Rap1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04114  Oocyte meiosis
ptr04218  Cellular senescence
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04714  Thermogenesis
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04728  Dopaminergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04917  Prolactin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05014  Amyotrophic lateral sclerosis
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05205  Proteoglycans in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104003820 (MAPK11)
   04015 Rap1 signaling pathway
    104003820 (MAPK11)
   04370 VEGF signaling pathway
    104003820 (MAPK11)
   04668 TNF signaling pathway
    104003820 (MAPK11)
   04068 FoxO signaling pathway
    104003820 (MAPK11)
   04071 Sphingolipid signaling pathway
    104003820 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104003820 (MAPK11)
   04218 Cellular senescence
    104003820 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104003820 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104003820 (MAPK11)
   04613 Neutrophil extracellular trap formation
    104003820 (MAPK11)
   04620 Toll-like receptor signaling pathway
    104003820 (MAPK11)
   04621 NOD-like receptor signaling pathway
    104003820 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    104003820 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    104003820 (MAPK11)
   04660 T cell receptor signaling pathway
    104003820 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    104003820 (MAPK11)
   04659 Th17 cell differentiation
    104003820 (MAPK11)
   04657 IL-17 signaling pathway
    104003820 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    104003820 (MAPK11)
   04670 Leukocyte transendothelial migration
    104003820 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104003820 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    104003820 (MAPK11)
   04917 Prolactin signaling pathway
    104003820 (MAPK11)
   04926 Relaxin signaling pathway
    104003820 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    104003820 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104003820 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    104003820 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    104003820 (MAPK11)
   04722 Neurotrophin signaling pathway
    104003820 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104003820 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104003820 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    104003820 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104003820 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104003820 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104003820 (MAPK11)
   05020 Prion disease
    104003820 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    104003820 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104003820 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104003820 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104003820 (MAPK11)
   05135 Yersinia infection
    104003820 (MAPK11)
   05133 Pertussis
    104003820 (MAPK11)
   05152 Tuberculosis
    104003820 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104003820 (MAPK11)
   05161 Hepatitis B
    104003820 (MAPK11)
   05171 Coronavirus disease - COVID-19
    104003820 (MAPK11)
   05163 Human cytomegalovirus infection
    104003820 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104003820 (MAPK11)
   05169 Epstein-Barr virus infection
    104003820 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104003820 (MAPK11)
   05140 Leishmaniasis
    104003820 (MAPK11)
   05142 Chagas disease
    104003820 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104003820 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    104003820 (MAPK11)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104003820 (MAPK11)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104003820 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 104003820
NCBI-ProteinID: XP_016794967
UniProt: K6Z8H5 A0A6D2Y813
LinkDB
Position
22
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctccgtctgttcg
gcctacgacgcccggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcagaacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcaattcctggtttaccagctgctgcgcgggctgaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggatttcgggctggcacgccaggcggacgaggagatgacc
ggctatgtggccacacgctggtaccgggcacctgagatcatgctcaactggatgcattac
aaccaaacagtggatatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccctgaggttctggcaaaaatctcctcggaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccgtggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgcggct
gaggcactggcccacgcctacttcagccagtaccacgaccccgaggatgagccagaggcc
gagccatatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acttaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

KEGG   Pan troglodytes (chimpanzee): 450161
Entry
450161            CDS       T01005                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04015  Rap1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04114  Oocyte meiosis
ptr04218  Cellular senescence
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04714  Thermogenesis
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04728  Dopaminergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04917  Prolactin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05014  Amyotrophic lateral sclerosis
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05205  Proteoglycans in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    450161 (MAPK14)
   04015 Rap1 signaling pathway
    450161 (MAPK14)
   04370 VEGF signaling pathway
    450161 (MAPK14)
   04668 TNF signaling pathway
    450161 (MAPK14)
   04068 FoxO signaling pathway
    450161 (MAPK14)
   04071 Sphingolipid signaling pathway
    450161 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    450161 (MAPK14)
   04218 Cellular senescence
    450161 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    450161 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    450161 (MAPK14)
   04613 Neutrophil extracellular trap formation
    450161 (MAPK14)
   04620 Toll-like receptor signaling pathway
    450161 (MAPK14)
   04621 NOD-like receptor signaling pathway
    450161 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    450161 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    450161 (MAPK14)
   04660 T cell receptor signaling pathway
    450161 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    450161 (MAPK14)
   04659 Th17 cell differentiation
    450161 (MAPK14)
   04657 IL-17 signaling pathway
    450161 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    450161 (MAPK14)
   04670 Leukocyte transendothelial migration
    450161 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    450161 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    450161 (MAPK14)
   04917 Prolactin signaling pathway
    450161 (MAPK14)
   04926 Relaxin signaling pathway
    450161 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    450161 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    450161 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    450161 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    450161 (MAPK14)
   04722 Neurotrophin signaling pathway
    450161 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    450161 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    450161 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    450161 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    450161 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    450161 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    450161 (MAPK14)
   05020 Prion disease
    450161 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    450161 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    450161 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    450161 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    450161 (MAPK14)
   05135 Yersinia infection
    450161 (MAPK14)
   05133 Pertussis
    450161 (MAPK14)
   05152 Tuberculosis
    450161 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    450161 (MAPK14)
   05161 Hepatitis B
    450161 (MAPK14)
   05171 Coronavirus disease - COVID-19
    450161 (MAPK14)
   05163 Human cytomegalovirus infection
    450161 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    450161 (MAPK14)
   05169 Epstein-Barr virus infection
    450161 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    450161 (MAPK14)
   05140 Leishmaniasis
    450161 (MAPK14)
   05142 Chagas disease
    450161 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    450161 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    450161 (MAPK14)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     450161 (MAPK14)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   450161 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 450161
NCBI-ProteinID: NP_001009065
Ensembl: ENSPTRG00000018097
VGNC: 7197
UniProt: Q95NE7 K7BNX5 A0A663DIP8
LinkDB
Position
6
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcaaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattaaccagcttcagcagattatgcgtctgacagga
acaccccccgcttatctcattaacaggatgccaagccatgaggcaagaaactatattcag
tctttgactcagatgccaaagatgaactttgcgaatgtatttattggtgccaatccgctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

KEGG   Pan troglodytes (chimpanzee): 462644
Entry
462644            CDS       T01005                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04015  Rap1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04114  Oocyte meiosis
ptr04218  Cellular senescence
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04714  Thermogenesis
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04728  Dopaminergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04917  Prolactin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05014  Amyotrophic lateral sclerosis
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05205  Proteoglycans in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    462644 (MAPK13)
   04015 Rap1 signaling pathway
    462644 (MAPK13)
   04370 VEGF signaling pathway
    462644 (MAPK13)
   04668 TNF signaling pathway
    462644 (MAPK13)
   04068 FoxO signaling pathway
    462644 (MAPK13)
   04071 Sphingolipid signaling pathway
    462644 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    462644 (MAPK13)
   04218 Cellular senescence
    462644 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    462644 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    462644 (MAPK13)
   04613 Neutrophil extracellular trap formation
    462644 (MAPK13)
   04620 Toll-like receptor signaling pathway
    462644 (MAPK13)
   04621 NOD-like receptor signaling pathway
    462644 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    462644 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    462644 (MAPK13)
   04660 T cell receptor signaling pathway
    462644 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    462644 (MAPK13)
   04659 Th17 cell differentiation
    462644 (MAPK13)
   04657 IL-17 signaling pathway
    462644 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    462644 (MAPK13)
   04670 Leukocyte transendothelial migration
    462644 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    462644 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    462644 (MAPK13)
   04917 Prolactin signaling pathway
    462644 (MAPK13)
   04926 Relaxin signaling pathway
    462644 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    462644 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    462644 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    462644 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    462644 (MAPK13)
   04722 Neurotrophin signaling pathway
    462644 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    462644 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    462644 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    462644 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    462644 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    462644 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    462644 (MAPK13)
   05020 Prion disease
    462644 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    462644 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    462644 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    462644 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    462644 (MAPK13)
   05135 Yersinia infection
    462644 (MAPK13)
   05133 Pertussis
    462644 (MAPK13)
   05152 Tuberculosis
    462644 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    462644 (MAPK13)
   05161 Hepatitis B
    462644 (MAPK13)
   05171 Coronavirus disease - COVID-19
    462644 (MAPK13)
   05163 Human cytomegalovirus infection
    462644 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    462644 (MAPK13)
   05169 Epstein-Barr virus infection
    462644 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    462644 (MAPK13)
   05140 Leishmaniasis
    462644 (MAPK13)
   05142 Chagas disease
    462644 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    462644 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    462644 (MAPK13)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     462644 (MAPK13)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   462644 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo DUF4023 FTA2 DUF3231
Other DBs
NCBI-GeneID: 462644
NCBI-ProteinID: NP_001029261
Ensembl: ENSPTRG00000018098
VGNC: 7195
UniProt: Q9N272 K7AUK7 A0A6D2W9Q9
LinkDB
Position
6
AA seq 365 aa
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggctccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccgacccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactcggctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcgcgacatgcagacgccgagatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaggaaggatttcactcagctgttcccacgggccagcccccag
gctgcggacctgctggagaagatgctggagctagacgtggacaagcgcctgacggctgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgtttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
agtggcatgaagctgtag

KEGG   Pan troglodytes (chimpanzee): 747077
Entry
747077            CDS       T01005                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04015  Rap1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04114  Oocyte meiosis
ptr04218  Cellular senescence
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04714  Thermogenesis
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04728  Dopaminergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04917  Prolactin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05014  Amyotrophic lateral sclerosis
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05205  Proteoglycans in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    747077 (MAPK12)
   04015 Rap1 signaling pathway
    747077 (MAPK12)
   04370 VEGF signaling pathway
    747077 (MAPK12)
   04668 TNF signaling pathway
    747077 (MAPK12)
   04068 FoxO signaling pathway
    747077 (MAPK12)
   04071 Sphingolipid signaling pathway
    747077 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    747077 (MAPK12)
   04218 Cellular senescence
    747077 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    747077 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    747077 (MAPK12)
   04613 Neutrophil extracellular trap formation
    747077 (MAPK12)
   04620 Toll-like receptor signaling pathway
    747077 (MAPK12)
   04621 NOD-like receptor signaling pathway
    747077 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    747077 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    747077 (MAPK12)
   04660 T cell receptor signaling pathway
    747077 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    747077 (MAPK12)
   04659 Th17 cell differentiation
    747077 (MAPK12)
   04657 IL-17 signaling pathway
    747077 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    747077 (MAPK12)
   04670 Leukocyte transendothelial migration
    747077 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    747077 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    747077 (MAPK12)
   04917 Prolactin signaling pathway
    747077 (MAPK12)
   04926 Relaxin signaling pathway
    747077 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    747077 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    747077 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    747077 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    747077 (MAPK12)
   04722 Neurotrophin signaling pathway
    747077 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    747077 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    747077 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    747077 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    747077 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    747077 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    747077 (MAPK12)
   05020 Prion disease
    747077 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    747077 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    747077 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    747077 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    747077 (MAPK12)
   05135 Yersinia infection
    747077 (MAPK12)
   05133 Pertussis
    747077 (MAPK12)
   05152 Tuberculosis
    747077 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    747077 (MAPK12)
   05161 Hepatitis B
    747077 (MAPK12)
   05171 Coronavirus disease - COVID-19
    747077 (MAPK12)
   05163 Human cytomegalovirus infection
    747077 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    747077 (MAPK12)
   05169 Epstein-Barr virus infection
    747077 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    747077 (MAPK12)
   05140 Leishmaniasis
    747077 (MAPK12)
   05142 Chagas disease
    747077 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    747077 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    747077 (MAPK12)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     747077 (MAPK12)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   747077 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 747077
NCBI-ProteinID: XP_016794965
VGNC: 12897
UniProt: K7A0D7
LinkDB
Position
22
AA seq 367 aa
MSCPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAAEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPWQLGAR
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctgtccgccgcccgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagcccgtgggctcgggcgcctacggcgcg
gtgtgctcggccgtggacagccgcaccggcgctaaggtggccatcaagaagctgtatcgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
gacttcacggacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgctggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggacttcggcctggccaggcaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcggagatgatc
acaggcaagacgctgttcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaattggagaagaaggattttgcctctatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgggtg
acagcagccgaggcgctggcccatccctacttcgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgtggaccgcacactggatgaatgg
aagcgtgttacttacaaagaggtgctcagcttcaagcctccctggcagctgggggccagg
gtctccaaggagacggctctgtga

DBGET integrated database retrieval system